KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270682
Entry
DDB_G0270682      CDS       T00245                                 

Gene name
tspD
Definition
(RefSeq) tetraspanin family protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Tetraspanin CcmH EMP70
Other DBs
NCBI-GeneID: 8617332
NCBI-ProteinID: XP_646377
dictyBase: DDB_G0270682
UniProt: Q55CV4
Position
1
AA seq 230 aa
MVEYLPSTPRYLKVPLIILNVILWLLGLVLVIIGGICVGFFSRFKELQEVGGVSESIKSI
SVSLPAGVLSIGIFFMVLTVAGCIVAYKEKMVGLVFYTILMLVLLVVLIGIGGEALTYHN
ADIGIEIEDNWKNISYSNQSVVIKKLEQFFECCCFDESDLKLNCTALCPQDDQKNILYNG
TFCYDVIFGAVNSKLYLVGSAGVAIGVIELVSLMFALFLIVRLYKSNSYR
NT seq 693 nt   +upstreamnt  +downstreamnt
atggtagaatatcttccttcaactccacgttatttaaaagttccattaataatattaaat
gtcattctttggttattaggattagtacttgttattattggtggaatttgtgttggattt
ttttcaagatttaaagagttacaagaagtaggaggagtttcagaatcaataaagagtata
tcggtatcattaccagctggtgtattaagtattggtatattctttatggtattaacagta
gcaggatgtatcgtagcttataaagagaaaatggtaggattggtattctacacaatattg
atgttggttttattagttgttttaattggtattggtggtgaagcattaacttaccataat
gctgatatcggtattgaaatcgaagataattggaaaaacatctcatattcaaatcaaagt
gttgtaattaaaaaattggaacaattctttgaatgttgttgttttgatgaaagtgatcta
aaattaaattgtactgcattatgtccacaagatgatcaaaaaaatatattatataatggt
actttttgttatgatgtaatatttggtgctgtaaattcgaaattgtatttagttggtagt
gctggtgttgcaattggtgtgattgaattggtttcattaatgtttgctttatttttaatt
gttagattatataaatcaaattcttatagataa

DBGET integrated database retrieval system