KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270990Help
Entry
DDB_G0270990      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00071  Fatty acid degradation
ddi00592  alpha-Linolenic acid metabolism
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0270990
   00592 alpha-Linolenic acid metabolism
    DDB_G0270990
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0270990
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0270990
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     DDB_G0270990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Toxin_5
Motif
Other DBs
NCBI-GeneID: 8617350
NCBI-ProteinID: XP_646395
dictyBase: DDB_G0270990
UniProt: Q55CT6
Position
1
AA seq 692 aa AA seqDB search
MERLSIICNHFEDNDSLESNEVAANSNNNNINNNNNNGLATLNQNSLNNLIQINSKINLD
SEKIEKITKILFDHPDKEWTAARNRLIEVLKDPIFECKPYASFHEQRELAQKRVAHLASI
PGGPILKVGEIVSNYKKFSMFQSTLVYCDMSMAVKSSVHWGLFGASVCCLGSEKHEKYYD
DIDTCKMSGCFALTELAHGSNVKGVETIAEYDNKTQEFVIHTPSDTAQKIWIGNAATYGC
FATVFANLISNGENYGLHPFLVQIRDTTTLKPLAGITTADNGPKIGLNGVDNGRLWFNKV
RIPRDNLLNKFGDIDANGVYSTPIKNPSVRFNSMLESLIGGRITVANMANSAAKMGLYIA
LHYAFSRRQFGPSNGKEVLLIDYITHQRRLFPQLAEVYINQVGINYVINKFQNRTEKDAR
DVFLLACGFKAATTWNRSKTLQLCRECCGGQGMAASNKIGILRADTDVDLTYEGDNTVLM
QAVAKALLQEFKSYFTGTKRITGMLSYTYSKGHIGIFLRNKNFFTKRLHTESHLLDPDVL
LDAFIYREFKLLRNLIKTLRAKVKNEKMTGLQAWNSSLDLVLQLANAYIERVSIEKFLEE
VQKSPEDIKPILTSLCILYELTKIENDLGWFLSNKYFAPVKGQAIGNTINKVCGALKDHA
IPLVKAFDIPSQFLTAPIIGDWVSHFSNPNNC
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaaagattatcaattatttgtaatcattttgaagataatgattcattagaatcaaat
gaagttgcagcaaattctaataataataatattaataataataataataatggattagca
acattaaatcaaaattcattaaataatttaattcaaattaattcaaagattaacttggat
tcagaaaagattgaaaaaattacaaaaatattatttgaccatccagataaagaatggaca
gcagcacgtaatagattaatagaggtattgaaagatccaatctttgagtgtaaaccatat
gcgtcattccatgaacaaagagaattggcacaaaagagagtagcacatttagcatcgata
ccaggtggaccaattttaaaagttggtgaaatcgtatcaaactataagaaattttcaatg
tttcaatctacattggtctattgcgatatgtcaatggcagtgaaatcctcagtgcattgg
ggtttattcggagcatcggtatgttgtttaggttcagagaaacacgagaaatattacgac
gatatcgatacttgcaaaatgagtggctgttttgcattgacagagttggctcatggttca
aatgtgaaaggtgttgaaaccattgcagagtacgataacaagacacaagagtttgtaatt
cacacaccatcagacacagcacaaaagatttggattggtaatgctgcaacctatggttgt
tttgctacagtgtttgcaaatttaatttcaaatggcgagaattatggtttacatccattc
cttgtacaaattagagacaccacaacattgaaaccattggcaggcatcacaacagctgat
aacggaccaaagattgggttgaatggtgttgataatggtcgtttatggtttaacaaggtt
agaatcccacgtgataatcttttgaacaagtttggtgatattgatgccaatggtgtttat
agtacaccaattaagaatccaagcgttcgtttcaattcaatgttagagtcgttgattggt
ggtcgtatcactgttgcaaatatggcaaattcagcagcaaagatgggactttacattgct
ttacattatgcattctcacgtcgtcaatttggtccatccaatggtaaagaggtgttgtta
atcgattatatcacacatcaacgtcgtttattcccacaattggcagaggtttacatcaat
caagtcggtataaattatgttatcaataaattccaaaatagaactgaaaaggatgcaaga
gatgtcttcctattggcatgtggtttcaaagcagcaacaacttggaatcgttcaaaaact
ttacaactctgtcgtgaatgttgtggtggtcaaggtatggcagcaagtaataaaattggt
attcttcgtgctgataccgatgtagatttaacctacgaaggtgataacacagtactaatg
caagccgttgccaaagcattgcttcaagagtttaaatcctatttcaccggtacaaaacgt
ataactggtatgttgagttacacctattccaagggccacattggtatctttttaagaaat
aaaaactttttcaccaaacgtttacacacagaatcccatctattggatccagatgtattg
ttggatgctttcatctatcgtgaattcaaactccttcgtaacttgatcaaaactcttaga
gccaaagtaaagaatgaaaaaatgacaggtcttcaagcttggaatagtagtttggattta
gtacttcaattggcaaatgcttacattgaaagagtttccattgagaaattcttggaagaa
gttcaaaaatctccagaagatattaaaccaatcttaacttcactttgtatcctctatgaa
ttaacaaagattgaaaatgatcttggttggttcctttcaaataaatactttgcaccagtt
aaaggtcaagcaattggtaatacaatcaataaggtttgtggtgcattaaaagatcatgca
attccattagttaaagcatttgatattccatctcaatttttaactgctccaattattggt
gattgggtttctcatttttcaaatccaaataattgttaa

DBGET integrated database retrieval system