KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0271344Help
Entry
DDB_G0271344      CDS       T00245                                 

Gene name
idhA
Definition
(RefSeq) isocitrate dehydrogenase (NAD+)
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00020  Citrate cycle (TCA cycle)
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
ddi01210  2-Oxocarboxylic acid metabolism
ddi01230  Biosynthesis of amino acids
Module
ddi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DDB_G0271344 (idhA)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     DDB_G0271344 (idhA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh PdxA
Motif
Other DBs
NCBI-GeneID: 8617822
NCBI-ProteinID: XP_645630
dictyBase: DDB_G0271344
UniProt: Q55BI2
Position
2
AA seq 354 aa AA seqDB search
MFSRKSLSIFSTLRNYSSSTSKIQKVTLIPGDGIGPEISESVKRVFSAVKAPIEWETVVV
DANTGISKEVIESISKNKIGLKGPISTPIGTGHQSLNLGLRKTFNLYANIRPCLSIPGHK
TRYNNVNTVVVRENTEGEYSGIENQPVKGVAQSIKIITKEASTRIAHYAFQYALANGRKK
VTCIHKANIMKQSDGLFVKSCREVSTRYPSIKYEELTIDNNCMQLVLDPNQMDVMVLPNL
YGDIVSDLCAGLIGGLGLTPSGNIGENGSAIFEAVHGTAPDIAGKNKANPTALILSSIMM
LRHLGHFHEASIIENAVLNTLTEGKVKTGDLGGNSSCSEYTDELVKKITESLNK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgttctcaagaaaatctttatctattttttctacattacgtaactattctagtagtaca
agtaaaattcaaaaagttacattaattccaggtgatggtattggtccagagatttcagaa
tcagttaaaagagtattttcagcagtcaaagcaccaattgaatgggaaactgttgtagtt
gatgccaatacaggtatttcaaaagaagttattgaatcaatttcaaaaaataagattggt
ttaaaaggtccaatctcaacaccaattggtacaggacatcaatcattgaatttaggtctt
cgtaagacttttaatttatatgccaacattagaccatgtctttcaattccaggtcataaa
acacgttacaacaatgtaaacaccgttgttgtcagagaaaatacagagggtgaatactct
ggtattgagaatcaaccagttaagggtgttgctcaatcaattaaaatcatcacaaaagaa
gcctccaccagaatcgcacactatgctttccaatacgccttggccaatggtagaaagaag
gtcacctgtattcacaaagcaaacattatgaaacaatccgatggtctctttgttaaatca
tgcagagaagtttcaactcgttatccatccattaaatatgaagaattaaccatcgataac
aattgtatgcaattggttttagatccaaatcaaatggacgttatggtactcccaaatctc
tatggtgatatcgttagtgatttatgtgctggtttaattggtggtttaggtcttacccca
tctggtaacattggtgaaaatggttctgctatctttgaagccgtccatggtactgcccct
gatattgctggtaaaaacaaggcaaatccaaccgctctcatcttatcatcaattatgatg
ttacgtcatctcggtcacttccatgaagcctcaatcattgaaaatgctgttttaaatact
cttactgaaggtaaagttaaaactggagatttaggtggtaattcatcttgttctgaatat
actgatgaacttgttaaaaaaattactgaatctttaaataaataa

DBGET integrated database retrieval system