KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272522Help
Entry
DDB_G0272522      CDS       T00245                                 

Gene name
sgkA
Definition
(RefSeq) sphingosine kinase
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00600  Sphingolipid metabolism
ddi01100  Metabolic pathways
Module
ddi_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    DDB_G0272522 (sgkA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     DDB_G0272522 (sgkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8618520
NCBI-ProteinID: XP_645126
dictyBase: DDB_G0272522
UniProt: Q86KF9
Position
2
AA seq 624 aa AA seqDB search
MSINSDYNKENNNISPLNTSSERRSSLRNSLNNSSNNNNNNVINTPTANSINSSGNFSPK
EFVSNIDGEEIIYQNQSVEYKQRLCTIQIKQSTLIIKFNEKGGFTKYLVSDTIVGSEITN
ESTNEYTIYSCVMNTLDVTKETRRRKQFSLRFRDRFELNQFNDKFVEAFLDTLPMGNPRE
RRIRVILNPKSGKKMSDSIFKDINELFKDSKIFVKKTVTKGPDHAKKIGYKFNLKKYDTI
VFISGDGLFHEFINGLLSRTDFEQARKIPLALIPGGTGNGIACSIGLQDPMSCALAVIRG
FTKPLDVSVIQQGDKKWCSILSLTWGIVSDVDIESEKYRALGDVRLILGAALRILNLRIY
RGKIWYLPALELNKTEIAKIPKCSYSCEICESDNPISTIENVISQQQQNNTTTNQLRRSS
LNNSSNGFSPKLNTSGSISNGNDDELRSMFSKEENIKIENEIHDHQNDDVLPLLKSSSDQ
HFIVPPTKLPNQQFLKETKEELFAKGWKVLEGEFIGIVASTVSHLASDFIASPTAHLSDG
LIDLVVINNNKKFSKAGLLSVLTESSTGAHVKSDLIDQYKVQAMILEPSNDREGIIAVDG
ELISYGRTSMECMRACINLICRTY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaatagtgattataataaagagaataataatatatcaccattaaatactagt
agtgaaagaagaagtagtttaaggaatagtttaaataatagcagtaataataataataat
aatgtaataaatacaccaacagctaattcaattaatagtagtggtaatttttcaccaaaa
gaatttgtatcaaatatagatggtgaggagataatttatcaaaatcaaagtgtagagtat
aaacaaagattatgtaccattcaaattaaacaatctacattaatcattaaattcaatgaa
aagggtggtttcactaaatatttagtatcagatacgatagttggatcagagataaccaat
gaatccaccaatgaatatacaatctactcatgtgtaatgaatacattggatgtgacaaag
gaaaccagaagaagaaagcaattctcattaagatttagagacagattcgaattgaatcaa
ttcaatgacaagtttgtagaggctttcttagacacccttccaatgggcaatccaagggag
agaagaatcagggttatcctaaatccaaaatctggtaagaaaatgtcggattccatcttt
aaagatatcaatgagctctttaaagattcgaaaatattcgtaaagaaaaccgttacaaaa
ggacctgaccatgcgaaaaagattggctataaattcaacctcaagaaatacgataccata
gttttcatatctggtgatggtttattccacgagtttatcaatggtcttttgagtagaacc
gactttgaacaagctagaaagataccattggctttgatcccaggtggcactggtaatggc
attgcttgttccatcggtttacaagatccaatgtcttgtgcattagcagttatacgtggt
ttcactaaaccattagatgttagtgtaattcaacaaggtgataaaaaatggtgttcaatc
ttgtctctaacttggggtatagtatccgatgttgatatagaatctgaaaagtatcgtgcc
ttgggtgatgttcgtctaatcttgggtgcagcattacgtattctaaacctacgtatctat
cgtggcaaaatttggtatttaccagctttagaattaaataaaacagaaattgctaaaatt
ccaaaatgttcttattcatgtgaaatttgtgaaagtgataatccaatttcaacaattgaa
aatgttatatctcaacaacaacaaaataatacaacaacaaatcaattaagacgttcatct
ttaaataatagtagtaatggattttcaccaaaattaaatactagtggtagtatttcaaat
ggaaatgatgatgaattaagatcaatgttttcaaaagaagagaatataaagattgaaaat
gaaatacatgatcaccaaaatgatgatgttttaccattacttaaatcatcaagtgatcaa
catttcattgttccaccaactaaattaccaaatcaacaattcttaaaagagacaaaagag
gagttatttgcaaaaggttggaaagttttagaaggtgaattcattggtatcgtcgcaagt
acagtatcccatttagcttcagatttcatcgcatctccaactgcacatctttctgatggt
ttaattgatttagtagtaattaataataataagaaatttagtaaagcaggtttattatca
gttttaacagaatcctcaactggtgctcatgtaaagagtgatctcattgatcaatataag
gttcaagctatgatcttagaaccaagtaatgatagagaaggtattattgctgtagatggt
gaattaatctcttatggtcgtacttcaatggaatgtatgagagcttgtattaatttaatt
tgtagaacttattaa

DBGET integrated database retrieval system