KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272684Help
Entry
DDB_G0272684      CDS       T00245                                 

Gene name
qdpr
Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00790  Folate biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DDB_G0272684 (qdpr)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     DDB_G0272684 (qdpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase RmlD_sub_bind Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-GeneID: 8618582
NCBI-ProteinID: XP_644903
dictyBase: DDB_G0272684
UniProt: Q86A17
Structure
PDB: 

Position
2
AA seq 231 aa AA seqDB search
MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKDSGEEEIKSVIEK
INSKSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQGGLF
VLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTPTNRK
YMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVTTWTNL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatatattagttttaggtggatcaggtgctttaggtgctgaagttgttaaa
ttttttaaatcaaagagttggaatacaatttcaattgatttccgtgaaaatccaaatgct
gatcattcttttacaattaaagattcaggtgaagaagaaattaaatcagtaattgaaaaa
atcaattcaaaaagtattaaagttgatacatttgtatgtgcagcaggtggttggtcaggt
ggtaatgcatcaagtgatgaatttttaaaatcagttaaaggaatgatcgatatgaattta
tattcagcatttgcatcagcacatattggagctaaacttttaaatcaaggtggtttattc
gttttaacaggtgcatcagcagcattgaatagaacatcaggtatgattgcctatggtgca
accaaagcagcaactcatcacattattaaagatttagcaagtgaaaatggtggtctccca
gccggttcaacttcattaggtatcttaccagttacattagatactccaaccaatcgtaaa
tacatgtctgatgctaactttgatgattggacaccactctctgaagtcgctgaaaaatta
tttgaatggtcaacaaactctgattcaagaccaaccaatggttctttagttaaatttgaa
actaaaagtaaagttaccacttggacaaatttgtaa

DBGET integrated database retrieval system