KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272857
Entry
DDB_G0272857      CDS       T00245                                 

Gene name
rapB
Definition
(RefSeq) Ras GTPase
  KO
K04353  Ras-related protein Rap-1A
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ddi04031]
    DDB_G0272857 (rapB)
GTP-binding proteins [BR:ddi04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    DDB_G0272857 (rapB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase
Other DBs
NCBI-GeneID: 8618614
NCBI-ProteinID: XP_644935
dictyBase: DDB_G0272857
UniProt: Q86L51
Position
2
AA seq 205 aa
MGKGNGKSKDSKGSEKSSTKTKFFVAVMGAGSVGKSALTVQFTQGVFIDKYDPTVEDTYT
KTFELDGEQVCIEVLDTAGSEVLVAMRELYMKNAEGFILVYSILVKSTFLEIKDIVEQLF
RVKEEEEVPIVLVGNKIDLDAHREVSTNEGKQLANSYPNCDFWEASSKDRINVDNVFFSI
VKRIKEKYKKEGAPVKEKKEKCIIM
NT seq 618 nt   +upstreamnt  +downstreamnt
atgggtaagggaaatggtaaatcaaaagattcaaaaggttcagagaaatcttcaacaaaa
acaaaattctttgtcgcagtaatgggcgctggttcagttggtaaatcagcactcactgtt
caattcactcaaggagttttcattgataaatatgatccaacagtagaagatacatataca
aaaacatttgaattagatggtgaacaagtatgtattgaagtattagatacagcaggttca
gaagtattagtagcaatgagagaattatatatgaaaaatgctgaaggttttatattagtg
tacagtattcttgttaaatcaacatttttagaaattaaagatatcgtcgaacaattattt
agagttaaagaagaagaagaagtaccaattgttttagttggtaacaaaatagatttagac
gctcacagagaagtttcaaccaacgaaggtaaacagttggccaactcttatccaaattgt
gatttctgggaagcttcttcaaaggatagaatcaatgttgataatgttttctttagtatc
gttaaaagaattaaagagaaatataagaaagaaggtgcaccagttaaagaaaaaaaagaa
aaatgtatcattatgtaa

DBGET integrated database retrieval system