KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273071
Entry
DDB_G0273071      CDS       T00245                                 

Symbol
vatD-1
Name
(RefSeq) vacuolar ATPase subunit DVA41
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00190  Oxidative phosphorylation
ddi01100  Metabolic pathways
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DDB_G0273071 (vatD-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0273071 (vatD-1)
SSDB
Motif
Pfam: vATP-synt_AC39
Other DBs
NCBI-GeneID: 8618907
NCBI-ProteinID: XP_644805
dictyBase: DDB_G0273071
UniProt: P54641
Position
2
AA seq 356 aa
MGLFGGRKHGGLFTFNKDDGYLEAILRGFKKGILSRADYNNLCQCDNLEDMKMHFISTDY
GDFLAGEPSPIHTTTIAEKATGKLVSEFNHIRNQAVEPLSTFMDFISYGYMIDNVVLLIT
GTLHERDISELVDKCHPLGLFKSMATLSVVHNVADLYNNVLIDTPLAPYIQGCLSEEDLD
EMNIEIIRNTLYKAYLEDFYNYCKYLGGQTELIMSDILKFEADRRSINITINSFGATELS
KDDREKLYPSLGLLYPEGTSKLGKAEDVDQVRGILEVYSTYRNFFSDGVNNEKSLEDSFF
EHEVHLNRMAFEDQYGYGVFYAYIKLREQEIRNIVWIAECISQNMKQKMNQYIPIF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgggtttatttggtggtagaaaacatggtggtttattcactttcaataaagatgatggt
tatttagaagctatcttaagaggtttcaaaaaaggtatcctctcaagagccgattacaat
aatttatgtcaatgcgataatttagaagatatgaaaatgcatttcatttcaacagattat
ggtgatttccttgcaggtgaaccatcaccaattcatacaaccaccattgcagagaaagca
acaggtaaattagtaagtgaattcaaccacattagaaatcaagcagtcgaaccactttca
acttttatggatttcatttcatatggttatatgattgataacgtcgttttattaatcact
ggtactctccacgaaagagatatctctgaattggtcgataaatgtcacccattaggttta
ttcaagtcaatggccactctctctgtcgttcataatgtcgctgacctttataataatgtt
ttaattgatacaccattagcaccatacattcaaggttgtttatcagaagaagatttagat
gaaatgaatattgaaattattagaaatactttatataaagcttatttagaagatttttac
aactattgcaaatatctcggtggtcaaactgaattgatcatgagtgatattttaaagttt
gaagcagatcgtagatcaatcaatatcacaatcaatagttttggtgcaactgaactctca
aaggatgatcgtgaaaaactttacccatccttaggtcttttatacccagaaggtactagc
aaacttggtaaagctgaagacgttgatcaagttagaggtatcctcgaagtttactctacc
tatcgtaatttcttctctgatggtgtcaacaacgagaaatcattggaagactcattcttt
gaacatgaagttcacttaaatcgtatggcttttgaagatcaatatggttatggtgtcttt
tacgcttacattaaattaagagaacaagaaattagaaatatagtttggattgctgaatgt
attagtcaaaatatgaaacaaaaaatgaatcaatacattccaatcttttaa

DBGET integrated database retrieval system