KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273291
Entry
DDB_G0273291      CDS       T00245                                 

Gene name
ddo-2
Definition
(RefSeq) D-amino-acid:oxygen oxidoreductase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00260  Glycine, serine and threonine metabolism
ddi00330  Arginine and proline metabolism
ddi00472  D-Arginine and D-ornithine metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DDB_G0273291 (ddo-2)
   00330 Arginine and proline metabolism
    DDB_G0273291 (ddo-2)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    DDB_G0273291 (ddo-2)
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    DDB_G0273291 (ddo-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0273291 (ddo-2)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     DDB_G0273291 (ddo-2)
SSDB
Motif
Pfam: DAO
Other DBs
NCBI-GeneID: 8618842
NCBI-ProteinID: XP_644742
dictyBase: DDB_G0273291
UniProt: Q556W1
Position
2
AA seq 346 aa
MNQNKNNNNKNPKINLLIIGCGCIGLSTGIIALKSGNYKSVSIWAKDLPPNTTSNKAAAL
WYPFLCNPLDLVGKWSAETMQYYKDHIINDPKSGTITKKVNEIFRRPHPEDPEWKPYIKS
FRRARKDELPDGYVDGYAIDDGFVMDTDMYMDYLVDQFKSLGGIIEQRHLVDIREAFVDH
DVVVNCTGLGSRELFNDRTIYPGRGQIIVIKNSTDRSIMDEEDHIAYVIPRLTNTVLGGT
NQEHDYNTNPTKKDTEEILKRVAMISPRFAKNRIEIQGVKVGLRPARHEIRLENEFFEGG
SKLVVHNYGHGGSGFTVSWGCAIEAIKLVDQGLPKLLHFNKLISKL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaatcaaaataaaaataataataataaaaatccaaaaattaatttattaattattgga
tgtggttgtattggtttatcaacaggtattattgcattaaagagtggtaattataagagt
gtatcaatttgggccaaagatttaccaccaaatacaacctcaaataaagcagcagcatta
tggtatccatttttatgtaatccactagatttagttggtaaatggtcagcagaaaccatg
caatattataaagatcatattattaatgacccaaaatcaggtacaatcacaaagaaagta
aatgaaattttcagacgtccacatccagaagatccagaatggaaaccatacattaaatca
tttagaagagctagaaaagatgaactaccagatggatatgtagatggttatgcaattgat
gacggtttcgttatggacactgatatgtatatggattatttagtcgaccaattcaaaagt
ttaggtggaatcattgaacaaagacacctcgttgatattcgtgaagcttttgttgaccat
gatgtagttgtaaattgcaccggtttaggatcacgtgaattattcaatgatcgtacaatt
tatccaggtcgtggtcaaattatcgttattaaaaactcaaccgatcgttcaatcatggat
gaagaagatcatatcgcatatgtaattccacgtttaacaaatacagttttaggtggtaca
aatcaagaacacgattacaatacaaatccaactaaaaaagatactgaagaaatcttaaaa
cgtgtagccatgatttcaccacgttttgctaaaaatagaattgaaattcaaggtgttaaa
gttggtctacgtcctgctagacatgaaattcgtttagaaaatgaattctttgaaggtggt
tcaaaattagtagttcataactatggtcatggtggtagtggtttcactgtaagttggggt
tgtgctattgaagcaattaaattagttgatcaaggtttaccaaaattattacattttaat
aaattaataagtaaattataa

DBGET integrated database retrieval system