KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273591Help
Entry
DDB_G0273591      CDS       T00245                                 

Definition
(RefSeq) MYND-type zinc finger-containing protein
  KO
K11426  SET and MYND domain-containing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0273591
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     DDB_G0273591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND DUF4698 Orf78 Secretin_N_2
Motif
Other DBs
NCBI-GeneID: 8619037
NCBI-ProteinID: XP_644412
dictyBase: DDB_G0273591
UniProt: Q557F6
Position
2
AA seq 413 aa AA seqDB search
MFKSFDGLKLSNSELEGRYIIANRDIDIGESILKCKSYFAVTCEDFKKNSCYNCIKLIKS
PSPQQVPRCFGCNEVWYCSEKCKQDNQAKHQHYECAFFNNIKSPKLIQNSKLDFDSYSEI
RIILGLLSRYYQDKLLNNKFNSSIIINNQQDDEEDFIKDTLDGVLDLVENDINEETNSVA
KEYIDNIIEYIINILKLTINNNSNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNIEELIK
LIRPLIQKVRCNQFGIWTKNDKCIGMAVSPSSSYFNHSCIPNCESVRDGSDMTFKSLFPI
KKGDQINISYLALDKSTKRRRDYLKFGYYFHCQCPRCNSTDIDPTGKLEDSLDNWISKFY
CHQKKCTGLYYSKLKLSLQSLTNIDNHEIQLSCSTCNDQLIVNSNFYLNKPNY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatcttttgatggattaaaattatcgaattcagagttagagggaaggtatatt
atagcaaatagagatattgacattggagagagtatattaaaatgtaaatcatattttgca
gttacatgtgaagattttaaaaagaatagttgttacaattgtataaagttaattaaatca
ccatcacctcaacaagtaccaagatgttttggatgtaatgaagtttggtattgtagtgaa
aaatgtaaacaagataatcaagcaaaacatcaacattatgaatgtgcatttttcaacaat
ataaaatcaccaaaattaattcaaaattcaaaactcgatttcgattcatactctgaaatc
agaataatacttggtttactctcaagatattatcaagataaattattaaataataaattc
aattcatcaataataataaataatcaacaagatgatgaagaagattttataaaagataca
ttggatggtgtattagatttagtagaaaatgatataaatgaagaaacaaatagtgtagca
aaagaatatattgataatattattgaatatattataaatatattaaaattaacaataaat
aataatagtaatgataataataataataataataataataataataataataataataat
aataataataataataataataataataataataataataatattgaagaattaattaaa
ttaattagaccattaattcaaaaagttagatgtaatcaatttggaatttggacaaagaat
gataaatgtattggtatggcagtatcaccaagtagtagttattttaatcattcatgtata
ccaaattgtgaatcggttagagatggtagtgatatgacatttaaatcattatttccaatt
aaaaaaggtgaccaaattaatatctcttatttggcattagataaatcaactaaaagacgt
agagattatttgaaatttggttactactttcattgtcaatgtccaagatgtaattcaaca
gatattgatccaactggtaaattagaggattcattagataattggatttcaaaattttat
tgccatcaaaagaaatgtacaggtttatattattcaaaattaaaattatcactacaatca
ttaaccaacattgataatcatgaaattcaattatcatgttcaacttgtaatgatcaatta
attgttaattcaaatttttatttaaataaaccaaattattaa

DBGET integrated database retrieval system