KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273805Help
Entry
DDB_G0273805      CDS       T00245                                 

Gene name
ndkC-2
Definition
(RefSeq) NDP kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00230  Purine metabolism
ddi00240  Pyrimidine metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Module
ddi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ddi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ddi_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DDB_G0273805 (ndkC-2)
   00240 Pyrimidine metabolism
    DDB_G0273805 (ndkC-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0273805 (ndkC-2)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     DDB_G0273805 (ndkC-2)
Membrane trafficking [BR:ddi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    DDB_G0273805 (ndkC-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 8619145
NCBI-ProteinID: XP_644519
dictyBase: DDB_G0273805
UniProt: P22887
Structure
PDB: 

Position
2
AA seq 155 aa AA seqDB search
MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHK
ERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNI
IHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaaataaagtaaacaaagaaagaactttccttgctgttaaaccagacggtgtt
gctcgtggtttagttggtgaaatcatcgccagatacgaaaagaaaggtttcgttttagtt
ggtttaaaacaattagttccaaccaaagacttagctgaatctcactatgctgaacacaaa
gaaagaccattcttcggtggtttagtctcattcattacctctggtccagtcgttgctatg
gtcttcgaaggtaaaggtgttgttgcctctgcccgtttaatgatcggtgttaccaaccca
ttagcctcagccccaggttcaattcgtggtgatttcggtgttgatgttggtagaaacatc
atccacggttctgattcagttgaatctgccaacagagaaattgctttatggttcaaacca
gaagaattattaactgaagttaaaccaaacccaaatttatacgaataa

DBGET integrated database retrieval system