KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274105Help
Entry
DDB_G0274105      CDS       T00245                                 

Gene name
glgB
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00500  Starch and sucrose metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DDB_G0274105 (glgB)
Enzymes [BR:ddi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DDB_G0274105 (glgB)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0274105 (glgB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 8619432
NCBI-ProteinID: XP_644004
dictyBase: DDB_G0274105
UniProt: Q555Q9
Position
2
AA seq 678 aa AA seqDB search
MTDYSKATDGTKVIHDDPWLEPYKEVIKRRHNQVKNTIQKLEESEGSLLKFSQGYEYFGF
NVTKDGVNYREWLPSAHEVYLVGDFNQWNKTSHPLERDNYGRWSIFIPNNSNGECAIPHG
SKIKIYLKLANGNFDYRIPAWIKRVEQTKENPVFDGVFWNPSKQYVFKNKSPMKPTELRI
YEAHVGMSSELPEISTYSKFKDTVLPMVKELGYNCIQLMAVMEHAYYASFGYQVTNFFAI
SSRFGTPEELKEMIDKAHEMGLLVFLDVVHSHASKNVLDGLNQLDGTDHHYFHSGGRGNH
ELWDSRLFNYGNWEVMRFLLSNLRFYVDEYHFDGFRFDGVTSMIYTHHGLSPACSYDDYF
GGAVDEDALNYLTLANVMLHTLNPSIVTIAEEVTGLATLCRPFSEGGGDFDYRLAMGIPD
KWIELVKEKKDEDWNMGTIAHMLSNRRYKEKNIAYAESHDQSLVGDKTLAFWLMDKEMYT
NMSVTTEETPIIDRGMSLHKMIRLITSSLGGDGYLNFMGNEFGHPEWVDFPREGNNNSLH
HARRRWDLYRNPLLRYKQLRDFDIAMNKAEQEFRWLSSDFAYISLKHEDDKIIVFERASL
IFIFNFHPSKSFSDYRIGSGVPGKFINVLDSDRKEFGGHVRIGKDNYHYTEDKPWHDRKY
SLLIYIPSRTCLVLKKVD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgactgattatagtaaagcaacagatggtacaaaggttattcatgatgatccatggttg
gaaccatataaagaagtaattaaaagaagacataatcaagttaaaaataccattcaaaaa
ttggaagaaagtgaaggtagtttattaaaattttctcaaggatatgaatactttggtttc
aatgttacaaaagatggtgtaaactatagagaatggttaccatctgctcatgaagtttat
ttagttggtgatttcaatcaatggaataaaacaagtcatccacttgaaagagataattat
ggtagatggagtattttcattccaaataattcaaatggtgaatgtgcaattccacatggt
tcaaaaattaaaatttatttaaaattagcaaatggtaattttgattatagaataccagca
tggattaaaagagttgaacaaaccaaagagaatccagtatttgatggtgtattttggaat
ccaagtaaacaatatgtatttaagaataaatcaccaatgaaaccaacagagttgagaatt
tatgaagcacatgttggtatgtcaagtgaattaccagagatatcaacatacagtaaattc
aaggatactgtattaccaatggtgaaggagttgggatacaattgtattcagttgatggca
gttatggagcatgcctattatgcatcgtttggttatcaagtgacaaatttctttgcaatc
agcagtagatttggcacaccggaggagttgaaagagatgattgataaagcacacgagatg
ggattgttggtgtttttagacgttgttcatagccatgcatcaaagaatgtgttggacggt
ctcaatcaattggacggcaccgatcatcattactttcactcgggtggtcgtggaaatcat
gagttgtgggatagcagattattcaattatggcaattgggaggtgatgagattcctttta
tcgaatttacgtttctacgttgacgagtatcatttcgatggattcagattcgatggtgta
acaagcatgatttacactcatcatggtttatcaccagcatgctcatacgacgactatttc
ggtggtgctgtcgacgaggatgcgttaaattatctcactttggcaaatgttatgctccac
acattgaatccatcaattgtcaccatcgcagaggaagtcactggtttagcaacactttgt
cgtccatttagtgagggtggtggtgatttcgattaccgtttagctatgggtatacctgat
aaatggatcgaattggtcaaggagaaaaaagatgaagattggaatatgggtactatcgct
cacatgctatcgaatcgtcgttacaaggagaagaatatagcatacgccgaatcacatgat
caatcattggtgggtgataaaactttggcattctggttaatggataaggaaatgtataca
aatatgtctgtcacaaccgaagagactccaatcattgatcgtggtatgtctttacataag
atgattcgtttgatcacttcttcattgggtggtgatggttatctaaattttatgggtaac
gagtttggtcacccagaatgggtggatttcccacgtgaaggtaataacaatagtttacat
catgctcgtcgtagatgggacctctatagaaatccattattaagatataaacaattacgt
gactttgatattgcaatgaataaagctgaacaagaattccgttggttatcttccgatttc
gcttatatctctttgaaacatgaagatgataaaatcatagttttcgaacgtgcttctctt
atctttatctttaactttcatccatctaaaagtttctctgattatagaattggttctggt
gtaccaggtaaatttataaatgttttagattctgatcgtaaagaatttggtggtcatgtt
cgtattggtaaagataattatcattatactgaagataaaccatggcatgatagaaaatat
tctttattaatttatattccatcaagaacttgtttagttttaaaaaaagttgattaa

DBGET integrated database retrieval system