KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275149Help
Entry
DDB_G0275149      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0275149
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     DDB_G0275149
Membrane trafficking [BR:ddi04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    DDB_G0275149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_2 Ank_5 Ank_3 Ank_4 Ank Zip DUF4512 DUF4834
Motif
Other DBs
NCBI-GeneID: 8619769
NCBI-ProteinID: XP_643729
dictyBase: DDB_G0275149
UniProt: Q8T2Q0
Position
2
AA seq 698 aa AA seqDB search
MIDHNNIIIGNSINSKTFSLIESVKNGKLKECIGYLEKIRLQNPSLDLGEIINSGDDCGN
TALHWACYKKWYDIVKYLLSMGADPNIANTDELQTPFQWACIGGDLHIVKYVLNNGGDPH
LQDKRGYNSLIHATQYNEISVVRYLLDKGGVNVDSPDFLQKTSLHWAAYQGHTQLLLFLV
NKGADINALDSLGRSPLHWAAFKGNSDPIKALCDFGSKTMEKDSNNQSPSDICSSQNHNY
LAHFIKTFNYHPFRKVGPLLYNIFWIIFAILLQLYFGFIFYHFTLIPALILFGASLTCCK
LFIEPITLSNSPNPLLPTWMITSFTVSFVYYVRYVVPAFPNIILTHTITLFVYSSYYYCA
FKLFFSDPGTVSSSTTSQDSKDFINAVEKELEIPEVCSTCLINKPIRAKHCRTCKRCVAR
FDHHCAWINNCVGVNNNLLFIILLCLFSLAYIISVTFNFKLMSIDENSPLYSEGKMEWWT
YHYSTYKGLILFTIYKSFIMAWLARLLYVQITGVINNVTMFELMKPPKGSKKKCCNHAPQ
DQNNNNNNNNTTTNNSSSSSSSNNNSTGTNNDNNNNNNLGTSSNESGQSNCNIDQHNDHD
GQSSEPLLNEVSIQIRSENGVEEDDDDENNKNPSNKSFNKNSRDLDPTQTNFRDSILIPK
RTNNNENPYDKGSRENIREFLYDTSKWFRTTTFSNKNF
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcataataatattataattggtaattcaattaatagtaaaacattttcatta
attgaatcagtaaagaatggtaaattaaaagaatgtattggatatttagaaaagattaga
ttacaaaatccgtcattagatttaggagaaataataaatagtggtgatgactgtggcaat
acagcattgcattgggcatgttataagaaatggtatgatattgtaaagtatttactatcg
atgggggccgacccgaatatagcaaacactgatgaattacaaacaccatttcaatgggca
tgcatcggtggtgatctccacatagtgaaatacgtactcaacaatggcggcgacccacac
ctccaagacaagcgtggctacaattcactaattcacgccacacagtataatgaaatcagc
gtagttcgttatctgttggataaaggcggtgtaaatgtagactcgcccgatttcctacaa
aaaacgtctctccactgggctgcctaccaaggtcatacccaactcctactctttctagtc
aacaaaggtgccgacatcaacgccttggactccctcggccgttctccattgcattgggct
gccttcaaaggtaactctgacccaattaaagcactctgtgattttggatcaaaaactatg
gaaaaagattcaaacaatcaatctccatctgacatctgttcttctcaaaatcataattat
ctcgctcatttcattaaaacatttaattatcatccatttagaaaagttggtcctttatta
tataatatattttggattatttttgcaattttattacaattatattttggatttatattt
tatcattttacattaataccagcattgatattatttggagcaagtttaacatgttgcaaa
ttatttattgaaccaattacattgtcaaattcaccaaatccattattaccaacatggatg
ataacttcatttacggtgtcattcgtatactatgttagatatgtggtaccagcatttcca
aatataattctaacacatacgatcacattgtttgtttattcaagttactattattgtgca
tttaaattgtttttcagtgatcctggtacggtttcctcttctacgacatcacaagattca
aaggatttcattaatgccgtcgaaaaggaattggaaataccagaggtttgttcaacttgt
ttaatcaataaaccaattcgtgcaaaacattgtagaacttgtaaaagatgtgtagcaaga
ttcgatcatcattgtgcttggattaataattgtgttggtgtaaataataatttattattc
ataattttattatgtttattcagtttagcttatattattagtgtaacttttaattttaaa
ttaatgtcaattgatgagaattcgccattatattcagaaggtaaaatggaatggtggaca
tatcactattcaacttataaaggtttaattttatttacaatttataaatcattcattatg
gcatggttagcaagattattatatgtacaaataactggtgtaattaataatgtcacaatg
tttgaattaatgaaaccaccaaaaggttcaaagaagaaatgttgtaatcatgctccacaa
gatcaaaataataataataataataataatactactactaataatagtagtagtagcagt
agtagcaataataatagtacaggtacaaataatgataataataataataataatttaggt
acaagtagtaatgaaagtggtcaatcaaattgtaatattgatcaacataatgatcatgat
ggtcaatcaagtgaaccattattaaatgaagtttcaattcaaattcgtagtgaaaatgga
gttgaggaggatgatgatgatgaaaataataaaaatccttcaaataaatcatttaataaa
aactctagagatttagatccaactcaaactaattttagagattcaattttaattccaaaa
agaacaaataataatgaaaatccatatgataaaggttcaagagaaaatattagagaattc
ctttatgatacttcaaaatggtttagaactacaacttttagtaataaaaacttttaa

DBGET integrated database retrieval system