KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275323
Entry
DDB_G0275323      CDS       T00245                                 

Gene name
tipD
Definition
(RefSeq) autophagy protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    DDB_G0275323 (tipD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0275323 (tipD)
   03029 Mitochondrial biogenesis [BR:ddi03029]
    DDB_G0275323 (tipD)
Membrane trafficking [BR:ddi04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    DDB_G0275323 (tipD)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    DDB_G0275323 (tipD)
Mitochondrial biogenesis [BR:ddi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    DDB_G0275323 (tipD)
SSDB
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Crescentin WD40_like Cytochrom_D1 PD40 Fez1
Other DBs
NCBI-GeneID: 8619939
NCBI-ProteinID: XP_643673
dictyBase: DDB_G0275323
UniProt: O15736
Position
2
AA seq 612 aa
MFSSQNNSYMMMMGGGGIGNINNNQFYSPIISTSAQSFNSIVEWKRDIIRQLNDRNQNQT
NNYSEFMRIYTDLLKRERTLNDRTLLYEKEIVSLRNEKKTQQQPPSGSSKMDSSSSSSSS
NRVSGMGSTIEEMEQKLFKLQEDLTNSYKRNADNASSILLLNDKNKDLQNELMSKEIEIE
RIRSTIQQDLDSIKRLEMVVIEKENVSQIIRDELSSLQTEFLHNESKVVKLEQENSSLVE
RWLRKKNEEASKMNEANDFYQKMVEQRDSTPAKAAVQLSESISNLVVKLPDANDVPIPIV
LERGVFSSEAMLPSKAKKRWTGHNSEIYCMAFNSIGNLLATGGGDKCVKVWDVISGQQKS
TLLGASQSIVSVSFSPNDESILGTSNDNSARLWNTELGRSRHTLTGHIGKVYTGKFINSN
RVVTGSHDRTIKLWDLQKGYCTRTIFCFSSCNDLVILGGSGTHLASGHVDHSVRFWDSNA
GEPTQVLSSIHEGQITSITNSPTNTNQILTNSRDHTLKIIDIRTFDTIRTFKDPEYRNGL
NWTKASWSPDGRYIASGSIDGSICIWDATNGKTVKVLTKVHNNGSSVCCCSWSPLANIFI
SADKDKNIIQWE
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgttttcatcacaaaataattcatatatgatgatgatgggtggtggtggtattggtaat
ataaataataatcaattttattcaccaattattagtacatcagcacaatcatttaattca
atagtagaatggaaaagagatattataaggcaattgaatgataggaaccaaaatcaaacc
aacaattactctgaattcatgagaatatatacagatttattaaagagagaacgtacatta
aacgatcgtacattgttatatgaaaaagagatagtttcattaagaaacgagaaaaagaca
caacaacaacctccatcaggttcctctaaaatggattcgtcgtcgtcgtcgtcttcatcg
aatcgtgttagtggtatgggatcaacgattgaagaaatggagcaaaaactattcaaactt
caagaagatttaaccaatagttataaaagaaatgctgataatgcctctagcattctatta
ttaaatgataagaataaagatttacaaaatgaattaatgtcaaaagagattgaaatcgaa
agaattcgatcaactattcaacaagatttagattcaataaaaagattagaaatggttgta
attgaaaaagaaaatgtttcacaaattattagagatgaattatcatcattacaaacagaa
tttttacataatgaaagtaaagttgtaaaattagaacaagagaatagtagtttagttgaa
agatggttaagaaaaaagaatgaagaagcaagtaaaatgaatgaagcaaatgatttttat
caaaagatggtagaacaaagagatagtacaccagctaaagctgctgtacaattgagtgag
agtatttcgaatttggtggtgaaattaccagatgccaatgatgtaccaatacctattgta
ttggagaggggtgtattttcatcagaggcaatgctaccgagtaaagcgaaaaagagatgg
acaggtcataattctgagatctattgtatggctttcaattcaattggtaatcttttggca
actggtggtggtgataaatgtgtaaaggtttgggatgtaattagtggtcaacagaaatca
acgttattgggtgcctcacaatcgattgtatcggttagtttctcaccaaatgatgaatcg
atattgggcacgagtaatgataattcagcacgtctttggaatacggaattgggtcgttca
agacacacattgactggccatattggtaaggtgtatacgggtaaattcataaactcgaat
cgtgtggtcacgggcagtcatgatcgtactatcaaattgtgggatcttcaaaagggttat
tgtacacgtaccatcttttgtttctcaagttgtaatgatttggtgatcctaggtggtagt
ggcactcatttagctagtggtcatgtcgatcatagtgtcagattttgggattcaaacgct
ggtgaaccaactcaagtactctcatcgattcacgagggtcaaatcacttcaatcacaaat
tcacccacaaataccaatcaaatccttacaaactctcgtgatcataccctaaagatcatc
gatatacgtacctttgatacaattagaacctttaaggatccagaatatcgtaatggtcta
aattggactaaagcttcttggtctccagatggtcgttatattgcatcaggttcaatcgat
ggttcaatttgtatttgggatgctacaaatggtaaaaccgttaaagttttaacaaaagtt
cataataatggttcttcagtttgttgttgttcttggtcaccattagcaaatatttttata
tctgctgataaagataaaaatataattcaatgggaataa

DBGET integrated database retrieval system