KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275381
Entry
DDB_G0275381      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: RAMP4
Other DBs
NCBI-GeneID: 8619969
NCBI-ProteinID: XP_643700
dictyBase: DDB_G0275381
UniProt: Q553P6
Position
2
AA seq 59 aa
MSQSRTLRQKSQKYQENIEKRGVASPKKKEDGLNINPYVLGFIIFVVVGSTLLQILKGQ
NT seq 180 nt   +upstreamnt  +downstreamnt
atgagccaaagtcgtaccctccgtcaaaaatcacaaaaataccaagaaaacattgaaaaa
agaggtgttgcttcaccaaagaagaaagaagatggtttaaatattaatccatacgttttg
ggtttcattatttttgttgtagttggttcaactcttttacaaatcctcaaaggtcaataa

DBGET integrated database retrieval system