KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275459
Entry
DDB_G0275459      CDS       T00245                                 

Definition
(RefSeq) RNA recognition motif-containing protein RRM
  KO
K11294  nucleolin
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ddi03009]
    DDB_G0275459
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0275459
Ribosome biogenesis [BR:ddi03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    DDB_G0275459
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     DDB_G0275459
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 8620229
NCBI-ProteinID: XP_643642
dictyBase: DDB_G0275459
UniProt: Q75K16
Position
2
AA seq 299 aa
MAKDQKAIESKKRKKEESESETESSEENNASSSSESESEDELKVVGEGSSSSKSTFTKKE
SAAKDESSNTKTDDDLKVFVGQLPSGVTEYDLKEYFSECGDISNIKILNSNPQRVAAFIT
FADEKGRDTAITYNGKDFNGQGSLRINGANSKPSDGEGEPTTIVCRNIAFTVDETLVKEF
FSKCGSISRVSLPVYEDSGRLKGFAFVSFDSEDAVEKAIALTGTKFEGREIQVERSQRGG
GRSSSFGRGGGRGGFGGGRGGRGGFGNGGGRGGFGGGRGGGRGGSGGRGGFGNKRGRFE
NT seq 900 nt   +upstreamnt  +downstreamnt
atggccaaagatcaaaaagctatcgaaagtaaaaaaagaaagaaggaagaatctgaatca
gaaactgagtcaagtgaggaaaacaatgcttcatcatcttcagaatcagaatcagaagat
gaattaaaagttgttggtgaaggttcatcctcatcaaagagcacttttaccaaaaaggaa
tcagctgccaaagatgaatcaagcaataccaaaactgatgatgacttaaaagtatttgtt
ggtcaattaccatcaggtgttactgaatacgacttaaaggaatacttctctgaatgtggt
gacatttcaaacattaaaatcttaaatagtaacccacaaagagttgccgctttcatcact
tttgccgatgaaaagggtagagatactgccatcacatacaacggtaaagacttcaacggt
caaggtagtctcagaatcaatggtgccaatagcaagccatccgacggtgaaggtgaacca
accacaatcgtctgtagaaatattgcattcactgtcgatgaaaccctcgttaaagaattc
ttctctaaatgtggttccatcagtcgtgtctccttaccagtctatgaagattctggtaga
ttaaagggtttcgcctttgtcagcttcgactctgaagatgccgttgaaaaagctattgca
ctcactggtactaaattcgaaggtcgtgaaattcaagttgaaagaagtcaacgtggtggt
ggtagatcatcatcattcggtcgtggtggcggtcgtggtggtttcggcggcggtcgtggt
ggtcgtggtggttttggtaacggcggtggtcgtggtggtttcggtggtggtcgtggaggc
ggtcgtggtggtagcggtggtcgtggtggtttcggtaacaaacgtggtagattcgaataa

DBGET integrated database retrieval system