KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275493
Entry
DDB_G0275493      CDS       T00245                                 
Symbol
cycB
Name
(RefSeq) G2/M-specific cyclinB
  KO
K21777  G2/mitotic-specific cyclin-B, other
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0275493 (cycB)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0275493 (cycB)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    DDB_G0275493 (cycB)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centrosome formation proteins
   Cyclins
    DDB_G0275493 (cycB)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Gloverin tRNA_NucTransf2
Other DBs
NCBI-GeneID: 8620178
NCBI-ProteinID: XP_643591
dictyBase: DDB_G0275493
UniProt: P42524
Position
2:complement(6000211..6001649)
AA seq 436 aa
MSTINNPLNIKTRSHSSMGGGMIMDENKVPKSSIGMDKKIGGTTGLKSHRGALSDLTNNT
HQTTGMATKTVQLSNNNIIMPQPTNTRNNIITRSKSIIDNGASLRNSALISGVLPNANGP
VNKVQKRDIQSMEMMNNIPQQPVMIDDVDNDTNMIQEEQMVIDITEVPENIDIYDSHDPQ
CVGEYVNEIFAYYREKEQIDKIDKDYIKNQYHINERMRAILVDWMMAVHVRFKLLSETFF
LSVNIVDRYLAKVMIPVTKLQLVGITAILLACKYEEIYSPQIKDFVHTSDDACTHAEVID
MERQILSTLQFHMSVATPLHFLRRFSKAAGSDSRTHSLSKYLSELSMVEYRMVQFVPSMI
AAASIYVARRMTMKSGPYWNVTLEYYTCYKESEILQCAQELKEVRKRADTSNLKATRKKY
LSSKLMEVAAIPVVEF
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtcaacaattaataaccctctaaatattaaaacaagatcacattcatcaatgggtgga
ggtatgattatggatgaaaacaaagtaccaaaatcatcaattggtatggataagaaaatt
ggtggtacaactggattaaaatcacacagaggtgccctttctgatttaacaaataataca
catcaaacaactggaatggcaactaaaactgtacaattgtcaaataataatattattatg
ccacaaccaacaaatactagaaataacattattacaagatcaaaatcaattattgataat
ggtgcaagtttacgtaattcagcattaattagtggagttttaccaaatgccaatggacca
gtaaataaagtacaaaagagagatattcaatcaatggaaatgatgaataatattccccaa
caaccagttatgattgacgatgttgataacgataccaatatgattcaagaggaacaaatg
gtcattgacattacagaggtaccagagaatatcgatatctatgatagccacgatccacaa
tgtgttggtgaatatgttaatgaaattttcgcatactaccgtgagaaggagcaaatcgat
aagattgacaaagactatataaagaatcaataccatatcaatgaacgtatgcgtgcaatc
ctcgtcgattggatgatggctgttcatgtccgtttcaagttgttatctgaaactttcttc
ctctctgtcaatatcgtcgatcgttatctcgctaaagtaatgattccagtcactaaactc
caattggttggtattaccgccattttgttagcttgtaaatatgaagagatctacagtcca
caaatcaaggatttcgttcatacatccgatgatgcctgcacccacgccgaggttatcgac
atggaaagacaaatcctctcaactttgcaattccacatgtctgtcgccactcctttacac
tttttacgtcgtttctcaaaggctgctggatcagactctcgtactcattcactcagtaaa
tacctctctgaactctcaatggttgaatacagaatggttcaattcgttccatcaatgatt
gccgccgcttcaatctatgtcgctcgtcgtatgaccatgaagtctggtccatactggaat
gtaacacttgaatattacacttgttacaaggagtctgaaatcttacaatgtgctcaagaa
ctcaaagaagttagaaagagagctgacacctctaaccttaaagccacaagaaagaaatac
ttgtcttcaaagttaatggaagtcgctgcaattccagttgttgaattttaa

DBGET integrated database retrieval system