KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275537Help
Entry
DDB_G0275537      CDS       T00245                                 

Gene name
cytC
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 8620073
NCBI-ProteinID: XP_643492
dictyBase: DDB_G0275537
UniProt: Q869N1
Position
2
AA seq 113 aa AA seqDB search
MSDIIARGNVENGDKLFKARCAQCHTTANGAPNKQGPNLYGLFFPKSRSFPGYAYSDPNK
NTGKFCIMWGEQTLFDYLENPKKYIPKTKMAFAGFKSEQDRADVVAYLEQSTK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattattgcaagaggtaacgtcgaaaacggtgacaaacttttcaaagcaaga
tgtgctcaatgtcacaccactgctaatggtgcaccaaacaaacaaggtccaaatctttac
ggtttattctttcctaaatcacgttccttccctggttatgcctactctgaccccaacaaa
aacactggaaagttttgtatcatgtggggtgaacaaactctctttgattacttagaaaat
ccaaagaaatacattccaaagactaaaatggcctttgctggtttcaaatctgaacaagat
agagctgatgttgtcgcttaccttgaacaatcaactaaataa

DBGET integrated database retrieval system