KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275955
Entry
DDB_G0275955      CDS       T00245                                 

Symbol
rabH
Name
(RefSeq) Rab GTPase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU
Other DBs
NCBI-GeneID: 8620273
NCBI-ProteinID: XP_643388
dictyBase: DDB_G0275955
UniProt: Q86JC8
Position
2
AA seq 198 aa
MIKDNIKLKLTIIGDWNVGKSSLLYRFFNDVFYEQTKLSMGEHFFYKTVLIRGESIDLQI
TDTSGMEKFRSLNNSFYSNLDGILIVYDISDQETFENTKLWLNEANKLAPKDCIKIIVAS
KFDLENKVVDSNIVKSYADNLNLKFFETSSKNSINVEETFITLVEDILLKKNYQFNNITK
NKNNQDEDFNKKKGCSIN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgattaaagataatattaaattaaaattaacaataatcggtgattggaatgttggaaaa
tcatcattattatatagattttttaatgatgttttttatgaacaaaccaaactatcaatg
ggtgaacactttttttataaaacagttttaatacgtggtgaaagtatagatttacaaata
acagatacatcaggtatggagaaattcagatctctaaacaattctttttatagtaattta
gatggaattttaatagtatatgatatatctgatcaagaaacatttgaaaataccaaactt
tggcttaatgaagcaaataaattagcaccaaaagattgtataaaaataattgttgcaagt
aaatttgatttggaaaataaagttgttgattcaaatattgtaaaatcatatgctgataat
ttaaatttgaaattttttgaaacaagttctaaaaattcaataaatgttgaagaaactttt
atcacattagtagaggatattttattaaaaaagaattatcaatttaataatattacaaaa
aataaaaacaatcaagacgaagattttaataaaaaaaaaggttgttcaataaattaa

DBGET integrated database retrieval system