KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275983
Entry
DDB_G0275983      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: AAA_16 AAA_22 AAA AAA_7 Rad17 RNA_helicase ResIII PIF1 AAA_19 Sigma54_activat AAA_11 ABC_tran DUF2791 ATP-synt_ab AFG1_ATPase AAA_14 AAA_18
Other DBs
NCBI-GeneID: 8620247
NCBI-ProteinID: XP_643364
dictyBase: DDB_G0275983
UniProt: Q552L8
Position
2
AA seq 440 aa
MQRLLDTINKKFSLQTDIDPAKPKNKKNENEEKNKVPGRDSQYRKLKTFIDKTAKSGKGD
SLYICGPPGTGKSLTLTTLSKNLSTKKYKPIYINCMQFNQPIKIYIEIYRKLENLVSTKK
GVNESLDLIESKYFYDFDNKEEEGMEKHSDKNENEKKTMWVKYREYEIDILIEKFSNILY
RIFEWPTKDSSKLILFGIANDLGLVQKSLPRFAKIGMEIEVLHFKPYTEEEILKIFHHRI
DLVFKEYKLKEEDQKEQLFEPETLEMISKQLSVNGCDIRKAFDVIRRLVTLKFEKYIENA
DSNDSLDEDPDEVIEFKSPGEYFFSMDLVQDVLAEFFECKIVSNMKSLPLQAQIILFSSF
LPVLNYETLYKSYKSQCSIINFPLMEKADFGLSIDSIISNGLMKIESGKKIALLFSKEQL
ISAFKSSIIFDPLLEELNNL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcaaagattattagatacaatcaataaaaaattttcacttcaaactgatatagatcca
gcaaaaccaaaaaataaaaaaaatgaaaacgaagaaaagaataaagttccaggtagagat
tctcaatataggaaattaaaaacgttcattgacaaaactgcaaagtctggtaaaggagat
tcattatatatttgtggaccacctggaactggtaaaagtttaacattaacaacattatct
aaaaatttatcaacaaagaaatataaaccaatttacataaattgtatgcagtttaatcaa
ccaataaaaatttatatagaaatttatagaaaattagagaatttagtaagcacaaaaaaa
ggtgtaaatgaatcattagatttaatagaatcaaaatatttttacgattttgataataaa
gaagaagaagggatggaaaaacattcagataaaaatgaaaatgaaaaaaaaacaatgtgg
gtaaaatatagagagtatgaaattgatattttaattgaaaagtttagtaatatattatat
aggatatttgaatggccaactaaagatagttcaaaattaatattatttggaattgcaaat
gatttaggattagtacagaaatcattaccaagattcgctaaaattggtatggagattgaa
gttttacattttaaaccatatacagaggaagaaattttaaagatttttcatcaccgtata
gatttagtttttaaagagtataaattaaaggaagaggatcaaaaggaacaattattcgag
ccagagacattggaaatgatatcaaaacaactttcagtcaatggttgtgacattaggaaa
gcatttgatgtcattagacgtttagtcactttaaaatttgaaaaatatattgaaaatgca
gattcaaacgattcattggatgaagatcctgatgaggtcattgaatttaaatcacctggt
gaatatttcttttcaatggatttagtacaagatgtattggctgaatttttcgaatgtaaa
atagtttcaaatatgaaaagtttaccacttcaagctcaaatcattttattttcttcattc
cttccagttttaaattatgaaactttatataaatcatataaaagtcaatgttcaattatt
aatttcccattaatggaaaaagcagattttggtttatcaattgattcaattatttcaaat
ggtttaatgaaaatagaaagtggtaaaaaaattgcattattattttcaaaagagcaatta
atttctgcatttaaatcctcaataatattcgatcccctactagaagaattaaataattta
taa

DBGET integrated database retrieval system