KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276227
Entry
DDB_G0276227      CDS       T00245                                 

Definition
(RefSeq) ADP-ribosylation factor-related
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Ras Roc Arf LRR_6
Other DBs
NCBI-GeneID: 8620282
NCBI-ProteinID: XP_643240
dictyBase: DDB_G0276227
UniProt: Q552H0
Position
2
AA seq 837 aa
MTTLTSHTTTIDNNNNNNSNSNSNSNINSNSNNSSNNENNTGFNKASSSSRNRSGSINIG
RNRSNSDSDCNNNNNNSNKIENDNESETNSKNTANSSPVLSSFKPYTNIVEYSKSEFNLM
TKSLRFIDKNRYLSTIKCTILGLSGVGKTSFMRRFSSGEFLIEESTTFGAIRTLHMMHYS
NLSLHLEIWDSGGHDRLRGLLPFYLSNANCVILMYDVCNSDSFRRTFETLSKQRKDIADG
ALIIVIGNKVDCDKKREVTTEQLEKKCLESLDTLGNISWCEISAKTGYNIREPFNIISKN
ISTMISILKSNHKSNSTQNHLNNSNNNSNSIMNNSGNNLSNSIGLSIFQNNSNNSNGGGG
GGGGGGIGNSNGNLPTFFELDEESQDDSDTNSSLPSHIMSNPDLVMIRNNHYSCLERSIK
PIPENVIIKLDQFKIELEPSINNLFNKFLSIKKKVYTFKEIMNNDENDFNNNSGNNSGNN
SNNTTPGNSGEVKGSFCIIVDKFHPKRIEFKRKSSTVTTSDVVLLCDYRDHLIKIFTSLC
PPKFKIPIVEGCSSSTITDFIVYFNDCLRYYSRDPIERSYIEKFNRLSSSLSSSSSSSST
TPTSSTSSSSSSTLKINTSGINGINNNEVLVNLNLSKMLKDEKYIISTSQSINWNASIET
LDISDNSLDKYDIKIFNELLQSINNSVSIINLNLSNNSLNFKHKNSLVEFMQSMKLKSLD
LSFNELFNSCNLIAQSLTHNSTLNYLSLAGNKLTNDNAQSLSQMIQSRNSVINNLNVSEN
LIEDEGALFLLKVQQQKQQQQQIYLNLQSNPIKHFSKFTTGSNSQPSSPITSKHNIY
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgactactttaacatcacacacaactactatcgataataataataataataatagtaat
agtaatagtaatagtaatattaatagtaatagtaataatagtagtaataatgaaaacaat
acaggatttaataaagcaagttcatcaagtagaaatcgaagtggtagtataaacattggt
aggaataggtcgaacagtgattctgattgtaataataataataataattcaaataaaatt
gaaaatgataatgaaagtgaaacaaatagtaaaaatacagcaaattcatcaccagtatta
tcatcatttaaaccatatacaaatatagttgaatattcaaaatctgaatttaatttaatg
acaaaatctttaagattcattgataaaaatagatatttatcaactataaagtgtacaatt
ttaggtttaagtggtgttggtaaaacatcatttatgagaagattttcatcaggtgaattt
ttaattgaagaatcaacaacatttggagcaattagaacattacatatgatgcattatagt
aatttatcattacatttagagatttgggattcaggtggtcatgatagattaagaggatta
ttaccattctatttatcgaatgcaaattgtgtgatattgatgtatgatgtttgtaatagt
gatagttttagaaggacatttgaaacattatcaaaacaaagaaaggatatagctgacggt
gcattaattatagtcattggtaataaagtcgattgtgataagaaacgtgaggtcacaaca
gaacaattggaaaagaaatgtttagaatcattagatacattgggtaatataagttggtgt
gaaatttctgcaaaaacaggttacaacattagagaaccatttaatataatctcaaagaat
atttcaacaatgatttcaattttaaaatcaaatcataaatcaaactctactcaaaatcat
ttaaataatagtaataataatagtaatagtattatgaataatagtggtaataatttatca
aattcaattggtttatcaatttttcaaaataatagtaataatagtaatggtggtggtggt
ggtggaggtggtggtggtattggtaatagtaatggcaatttaccaacatttttcgaattg
gatgaagaaagtcaagatgattcagatacaaattcatcattaccttcacatataatgtca
aatcctgatttggttatgattcgtaataaccattattcatgtttagagagatcaattaaa
ccaataccagagaatgtaattataaaattggatcaatttaaaattgaacttgaaccaagt
ataaataatttattcaataaattcttatcaattaaaaaaaaagtttatacatttaaagaa
attatgaataatgatgaaaatgattttaataataatagtggtaataatagtggtaataat
agtaataatacaactccaggtaatagtggtgaagttaaaggtagtttttgtataattgtg
gataaatttcacccaaaaagaattgaattcaaaagaaaatcctcaacagttacaacttct
gatgtcgttttactttgtgattatagagatcatttaattaaaatttttacttctttatgt
ccacctaaatttaaaattccaattgttgaaggttgtagtagtagtacaattacagatttt
attgtatattttaatgattgtttaaggtattattcgagagatccaattgaaagatcatat
attgaaaagtttaataggttatcatcatctttatcatcatcatcatcatcatcatcaact
acaccaacatcgtcaacatcgtcatcatcatcatcaacattaaaaattaatacaagtggt
attaatggtattaataataatgaagtattagttaatttaaatttgtcgaaaatgttaaaa
gatgaaaaatatataatttcaacctcacaatcaattaattggaatgcttcaattgaaaca
ttagatatttctgataattcattggataaatatgatataaaaatatttaatgaattatta
caatcaattaataattcagtatctattattaatttaaatttatctaataattctttaaat
tttaaacataaaaattcattagttgaattcatgcaatcaatgaaattaaaatcattagat
ttaagttttaatgaattatttaatagttgtaatttgattgcacaatcattgacacataat
tcaactttaaattatttatcattggctggtaataaattaacaaatgataatgctcaatcg
ttatctcaaatgattcaaagtagaaatagcgttatcaataatttaaatgtatctgaaaat
ttaattgaagatgaaggtgcattattcttattaaaagttcaacaacaaaaacaacaacaa
caacaaatttatttaaatttacaatctaatccaattaaacatttttcaaaatttacaact
ggttcaaattctcaaccttcttctccaatcacttcaaaacataatatttattaa

DBGET integrated database retrieval system