KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276399
Entry
DDB_G0276399      CDS       T00245                                 

Gene name
rab8B
Definition
(RefSeq) Rab GTPase
  KO
K07901  Ras-related protein Rab-8A
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    DDB_G0276399 (rab8B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0276399 (rab8B)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0276399 (rab8B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0276399 (rab8B)
   04031 GTP-binding proteins [BR:ddi04031]
    DDB_G0276399 (rab8B)
Membrane trafficking [BR:ddi04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    DDB_G0276399 (rab8B)
 Autophagy
  Other autophagy associated proteins
    DDB_G0276399 (rab8B)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    DDB_G0276399 (rab8B)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0276399 (rab8B)
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0276399 (rab8B)
  Exosomal proteins of colorectal cancer cells
   DDB_G0276399 (rab8B)
GTP-binding proteins [BR:ddi04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    DDB_G0276399 (rab8B)
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase G-alpha DUF3963 SRPRB AAA_29 AAA_16
Other DBs
NCBI-GeneID: 8620520
NCBI-ProteinID: XP_643115
dictyBase: DDB_G0276399
UniProt: P20791
Position
2
AA seq 203 aa
MTSPATNKPAAYDFLVKLLLIGDSGVGKSCLLLRFSDGSFTPSFIATIGIDFKIRTIELE
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFGSIRNWIRNIEQHASDS
VNKMLIGNKCDMTEKKVVDSSRGKSLADEYGIKFLETSAKNSVNVEEAFIGLAKDIKKRM
IDTPNDPDHTICITPNNKKNTCC
NT seq 612 nt   +upstreamnt  +downstreamnt
atgacttctccagcaacaaataaaccagcagcctacgattttttagttaaattactttta
attggggatagtggtgtaggaaagtcatgtcttttattacgtttttctgatggttctttc
acaccaagtttcatcgctactattggtatcgatttcaaaattcgtacaattgaattagag
ggtaaaagaattaaattacaaatttgggacactgcaggtcaagaaagattcagaactatc
actacagcatactatcgcggtgctatgggtatcctattggtttatgatgtcactgatgaa
aaatcttttggtagcattagaaattggattagaaatatcgagcaacatgcttcagactca
gttaataaaatgttaatcggtaataaatgtgatatgaccgaaaagaaagttgttgatagc
tcaagaggtaaatcacttgcagacgaatatggtattaaatttttagaaacttctgccaaa
aacagtgtaaatgtagaggaagcctttattggtttagcaaaagatattaaaaaacgtatg
attgatacaccaaatgatcctgatcataccatatgcattactccaaacaataagaaaaat
acttgttgttaa

DBGET integrated database retrieval system