KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276765
Entry
DDB_G0276765      CDS       T00245                                 

Gene name
ubqC
Definition
(RefSeq) ubiquitin/ribosomal protein S27a fusion protein
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03010  Ribosome
ddi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DDB_G0276765 (ubqC)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    DDB_G0276765 (ubqC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ddi03011]
    DDB_G0276765 (ubqC)
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0276765 (ubqC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0276765 (ubqC)
Ribosome [BR:ddi03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    DDB_G0276765 (ubqC)
  Archaea
    DDB_G0276765 (ubqC)
Ubiquitin system [BR:ddi04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   DDB_G0276765 (ubqC)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0276765 (ubqC)
  Exosomal proteins of colorectal cancer cells
   DDB_G0276765 (ubqC)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 IBR Rad60-SLD_2 Ubiquitin_5 TBK1_ULD DUF2407
Other DBs
NCBI-GeneID: 8620678
NCBI-ProteinID: XP_642815
dictyBase: DDB_G0276765
UniProt: P14797
Position
2
AA seq 154 aa
MQIFIKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGGKKKKKKTYATPKVLKRKLRKVKLAVLKYYKFDENGKIKRVLR
ECPAETCGAGVFMAQHANRQYCGKCHSTLVKKSK
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcaaattttcattaagacccttactggtaagaccatcaccctcgaggttgaaggttct
gataacattgaaaatgttaaagccaaaatccaagataaagaaggtatcccaccagatcaa
caaagattaatctttgccggtaaacaattagaagacggtcgtactctttccgattacaat
atccaaaaagaatcaactctccacttagtcttaagattaagaggtggtggtggtaaaaag
aagaagaagaagacctacgctaccccaaaggttctcaagagaaaattaagaaaagttaaa
ttagccgtcctcaaatactacaaattcgacgaaaacggtaaaatcaaacgtgtcttaaga
gaatgtccagctgaaacctgtggtgctggtgtcttcatggctcaacatgctaatcgtcaa
tactgtggtaaatgtcactcaactttagttaaaaaatccaaataa

DBGET integrated database retrieval system