KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277183
Entry
DDB_G0277183      CDS       T00245                                 

Gene name
H4a
Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0277183 (H4a)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    DDB_G0277183 (H4a)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Ribosomal_L29e Bromo_TP CBFD_NFYB_HMF Histone TFIID-31kDa TFIID-18kDa
Other DBs
NCBI-GeneID: 8620904
NCBI-ProteinID: XP_642712
dictyBase: DDB_G0277183
UniProt: Q76NW2
Position
2
AA seq 108 aa
MSSAQSRGGKTGGKVGGKVGAKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEET
RNVLRTFLTNVIRDSVAYTEHAGRRTVTAMDVVYALKRQGRTLYGFNS
NT seq 327 nt   +upstreamnt  +downstreamnt
atgagttcagcacaatcaagaggtggtaagacaggtggtaaagtcggtggtaaagttggt
gccaaacgtcataagaaaacccaaaaggaacacatcaacggtattactaagccagccatc
cgtcgtttagcccgtagaggtggtgtcaaacgtatctctttcccaatctacgaagaaact
agaaatgtattacgtactttcttaaccaacgttattcgtgattccgtcgcatacactgaa
catgcaggtcgtcgtactgttactgctatggatgtagtctatgctctcaagagacaaggt
agaactttatacggtttcaactcataa

DBGET integrated database retrieval system