KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277911
Entry
DDB_G0277911      CDS       T00245                                 

Gene name
mfeB
Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Other DBs
NCBI-GeneID: 8621617
NCBI-ProteinID: XP_642412
dictyBase: DDB_G0277911
UniProt: Q54XZ0
Position
3
AA seq 294 aa
MTVDVKKVINHKIKPIEYNLTRKDVALYAISLGCGKKHLKFVYEGSDNFSALPTLGVIFP
GQMIVDVISEGIDGIEFDPMMLLHGEQELEILNEIPVEGVFVTESKITNLYDKGKGALLI
LQCITSEKSSGKPIFKNIFSFFIRGIGGFGGDRGPNEKPIQIPKDRAPDAISKQATSEDQ
AVIYRLAGGDLNPLHIDPEMSKIGGFEVPILHGLCTYGIASRGVLEHFCDNDPSRLKSIK
TRFTKHVYPGETIETEMWKINPTTILFQSKTNRDGSYVLSSGVAIIEPIKKGSL
NT seq 885 nt   +upstreamnt  +downstreamnt
atgacagtggatgtaaaaaaagtaataaatcataagattaaaccaatcgaatataatctt
acaagaaaagatgttgcattgtatgcaattagtttaggatgtggtaaaaaacatttaaaa
tttgtttatgaaggttcagataatttctctgctttaccaacattgggtgttatatttcct
ggccaaatgattgttgatgtaatttcagaaggtattgatggaatagaatttgatccaatg
atgttattacatggtgaacaagaattagagattttaaatgagataccagttgaaggagta
tttgtaacagaatcaaagattaccaatctctatgataaaggtaaaggagcattattgata
ttacaatgtattacctctgaaaagtcaagtggtaaaccaatattcaagaatatattttca
ttctttattagaggtattggtggttttggtggtgatcgtggtccaaatgaaaaaccaatt
caaattccaaaagatagagcaccagatgcaatcagtaaacaagccacctctgaagatcaa
gctgtcatttatcgtttggctggtggtgatttaaatccattacatatcgatccagaaatg
agtaaaatcggtggttttgaagtaccaattttacatggtctttgtacttatggtattgct
tcaagaggtgttttagaacacttttgtgataatgatccaagtagattaaaatcaattaaa
actagattcactaaacatgtttatcctggtgaaactattgaaactgaaatgtggaaaatc
aatccaacaacaatcttattccaatctaaaacaaatagagatggtagttatgttttaagt
tctggtgttgctataattgaaccaattaaaaaaggttctttgtaa

DBGET integrated database retrieval system