KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278183Help
Entry
DDB_G0278183      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 zf-C3HC4_2 zf-RING_6 zf-C3HC4_3 zf-C3HC4 zf-RING_5 Prok-RING_4 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 8621392
NCBI-ProteinID: XP_642185
dictyBase: DDB_G0278183
UniProt: Q54YL7
Position
3
AA seq 601 aa AA seqDB search
MGESNNILPFIYNQPIEIDKELECSICLLPLFEPVVEQNCGSMFCNQCLLNNFNIGKNNC
PSCKQIINKNKLSNPPKIITNKLDELLVYCIQCKDNYPENEIKYMTRLYFIKNHSEFECK
TNECECQIISTTSKLTLNNDLITSPTNLKLYTKIELKHHKDNECILSSSNCSANNVSCPW
NGHLKDKDNHESTCSYISLKPHLLSLQSKISQLESEKTNSIQYQNFLETQINQLESKLSF
PISPPKYLYGRFIKYQQQLLDYQQQQYQQQQQYQHPPQQQVLTPYNKNNKIFEFSENSFK
YVNGVEIIKNKTKSISLGSDFNGEWPKLNEWLINTEVDTIILLDGFRHEIHVPISIKTLH
IGNIVVFGPITTYGASLTELHLHDGCSIKLDYNQLPKTVSTLHIYNINNPYSSPSSSLSS
FVKPMNQKLQQQSSKISILHLHDGFSIEGCQIPNSLRELHLYDIKVLSIKTPINLLELFL
HDGFNLPLENVLSKNITDLHLFNIKSNISSTPPMIGSSVKNLFLRDGFNQDIYIPPTVKW
LCLFNTQRPINIPKTIKKIYLQNYNFPRNNFPNGVKVYEQNPMNNNNNNNNNNNNNNNNN
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaatcaaataatattcttccatttatttataatcaaccaattgaaattgataag
gaattagaatgttcaatttgtcttttacctctcttcgaaccagttgtcgaacaaaattgt
gggtcaatgttttgtaatcaatgtttacttaataattttaatattggtaaaaataattgt
ccatcttgtaaacaaattataaacaaaaataaattatcaaatccacccaaaatcattaca
aacaaattagatgaattattggtttattgtattcaatgtaaagataattatccagaaaat
gaaattaaatatatgacccgtttatattttattaaaaatcattccgaatttgaatgtaaa
actaatgaatgtgaatgtcaaataatttcaacaacttctaaattaacattaaataatgat
ttaatcacatcaccaacaaatctaaaattatatactaaaatagaactaaaacatcataaa
gataatgaatgtatattatcaagttctaattgcagtgccaataatgtttcatgtccttgg
aatggtcatttaaaagataaagataatcatgaatcaacatgtagctacatatcattaaaa
ccacatttattatcacttcaatctaaaatatcccaattagaatctgaaaaaacaaatagt
atacaatatcaaaatttcttagagactcaaattaatcaattagaatcaaaactctcattc
ccaatttctcctccaaaatatttatatggtcgttttattaaatatcaacaacaactatta
gattatcaacaacagcaatatcaacaacaacaacaatatcaacatccaccacaacaacag
gtattaacaccatataataaaaataataaaatatttgaatttagtgaaaatagttttaaa
tatgtaaatggagttgaaattattaaaaataaaaccaaatcaatttcattaggaagtgat
tttaatggtgaatggccaaagttaaatgaatggttaataaatacagaagttgatacaata
atattattggatggatttagacatgaaatccatgtcccaatatcaattaaaactcttcat
attggtaatatagttgtttttggaccaattacaacctatggtgcttctctgactgaatta
catcttcatgatggttgttcaattaaattagattataatcaattaccaaaaacagtatca
actttacatatatataatattaataacccatattcatcaccatcatcatcattatcatca
tttgttaaaccaatgaatcaaaaactacaacaacaatcaagtaaaatttcaattttacat
ttacatgatggattttcaattgaaggttgtcaaattccaaattcattaagagaattacat
ctttacgatattaaagttctatcaataaaaacaccaattaatttattagaattattcctt
catgatggttttaatttaccgttggaaaatgtattgtcaaaaaatataacagaccttcat
ttattcaatattaaatcaaatatatcatcaacaccaccaatgattggtagtagtgttaaa
aatttatttttacgtgatggttttaatcaagatatttatattccaccaactgttaaatgg
ctttgtttatttaatactcaaagaccaattaatataccaaaaacaattaaaaaaatttat
cttcaaaattataattttcctcgtaataattttccaaatggtgtaaaggtttatgaacaa
aatccaatgaataataataataataataataataataataataataataataataataat
aaataa

DBGET integrated database retrieval system