KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278535Help
Entry
DDB_G0278535      CDS       T00245                                 

Definition
(RefSeq) ARK family protein kinase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ank_2 Ank_4 Ank Ank_5 Ank_3 SAM_1 SAM_2 SAM_4
Motif
Other DBs
NCBI-GeneID: 8621632
NCBI-ProteinID: XP_642427
dictyBase: DDB_G0278535
UniProt: Q54XX5
Position
3
AA seq 848 aa AA seqDB search
MNKSSSASTVPPHSTPHTAHSTSSSSLPPLSSTHHTNTSSTSNNNNNSNNNHNHNHHHTT
AATTTTSTTGTGTTAATTSTSTSSTIPINTAGIHTSNSNLATATNTPSSSPQVSTSVERR
FWMNDRGSRRSSTSLTQQPLTMNRSSNKLHAAVSARDLTRLKQRLSQPRKAKIELAEYDS
MDQTPLCAALRNGSHDIVREILFFYQSNKMDINDQDKSGYTPLHVAASHCDDQILMLLLN
YEGINVNITNEDKNSALHYFCQKFRSPNCQEPFSIFLKKGVNVNAQNKNGETPLHKSIFN
NTVRLLMVNMLLDAGAEVNVLNSRGESPLHFAVRLGREDLVSVLVKAGADITIKGNEKKT
CYELSLTIGNQRVINFLKNVQDIFNWLKSIDLEQYWLNFVKEEIFMDLLLDIDERTLDSL
GITYSGHRLKIIRNCRILRDQQLLSTANSNVTTGSGSSGSTTTTTTTTTTTSGCGGLNVP
ENKKVTQLSIESLKSNPPNSMDSTGSISSDDLKESLTNLEHWVIDHSELEYTLKLGSGSS
GKVYKGLYKGKEVAVKVLKSITTQSQLEEFKKEFQIMGSIRSQFMVTFYGACIEPKLCMV
MEYCSRDSLYHVMNTKKYDIGWDRFFQFTMQMTLGVQCLHNWTPQIVHRDFKSLNLLVNE
DWECKVSDFGLSRFNTADNLETLSKIRGTFAYCSPEVAVGNGSLYTTKSDIYSIGIVFWE
LVTRVINGEYSRPYSEYSHIKMDFQIMLNSKEGLRPTLPQNTPPGLEALYKQCVNQEQTL
RPSCEEIIETLNRLRHEYMSSKTTWDSLIRKLPSLSPPPQPTTTTTTTTSSSTSTNNINN
NINNNNNT
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagctcatcagcatcaacagttccacctcattcaacccctcatacagcacat
tcaacatcctcttcatctctacctccattatcatctacacatcacacaaatacatcatct
acgtcgaataataataataatagtaataataaccacaaccacaaccatcatcacactaca
gcagctacaacaacaacatcaacaacaggtacaggtactacagcagcaacaacatcaaca
tcaacatcatcaacaataccaataaatacagcaggaattcatacgagtaatagtaattta
gcgacagcaacaaatacaccatcatcatcaccacaagtttcaacatcagtagaaagaaga
ttttggatgaacgacagaggctcaagaagatcatcaacctcattaacacaacaaccatta
actatgaatagatcatcaaataaactacatgctgccgtctcagctagagatttaacaaga
ctaaaacaaagattatcacaaccacgtaaagcaaagatcgaattggcagaatatgattca
atggatcaaactcctctttgtgctgctttaagaaatggttcacatgatatagttagagaa
attttatttttctatcaatcaaataaaatggatattaatgatcaagataaaagtggttat
acaccattacatgttgcagcatctcattgtgatgatcaaattctaatgttattattaaat
tatgaaggcatcaatgtaaatataacaaatgaagataaaaattctgcacttcattacttt
tgtcaaaagtttagatcaccaaattgtcaagaaccattttcaatatttttaaagaaaggt
gtaaatgtaaatgcacaaaacaaaaatggtgaaaccccattacataaatcaatttttaat
aatactgttcgtttacttatggtaaacatgttattagatgcaggagcagaagtaaatgta
ttaaattcaagaggtgaaagtccacttcattttgcagttcgtcttggtagagaagattta
gtatcagttttagttaaagcaggagcagatattacaattaaaggaaatgaaaagaaaaca
tgttatgagttatctttaacgattgggaatcaaagagttataaattttttaaagaatgtt
caagatattttcaattggttgaaatcaatagatttggaacaatattggttaaattttgta
aaggaagagatatttatggacttactattggatattgatgaaagaacattggattcatta
ggtatcacctatagtggtcatcgtttaaaaataattagaaattgtagaatattaagagat
caacaactattgagtactgccaatagtaatgttaccacaggtagtggtagtagtggttca
acaacaacaaccaccaccactaccaccaccacctctggttgtggtggattaaatgtacca
gagaataaaaaggtaacacaattatcaatcgaatcattaaaatcaaatccaccaaatagt
atggattcaactggtagtattagttcagatgatttgaaagagtcattgacaaatcttgaa
cattgggttattgatcactcagagttggagtatacattaaaattgggtagtggtagttca
ggtaaggtttataaaggtttatataagggtaaggaagtggcagtcaaagtattgaaatca
atcaccactcaatcacaattggaggaatttaaaaaggaatttcaaattatgggttcaatt
cgttctcaatttatggtaacattttatggtgcatgcattgaaccaaaactttgtatggtc
atggagtattgtagtcgtgactcattgtatcatgtaatgaacaccaaaaagtatgacatt
ggttgggacagattctttcaattcaccatgcaaatgacattgggtgtacagtgtcttcac
aattggacacctcaaattgtacacagagactttaagagtttaaatcttttggtcaatgaa
gattgggaatgcaaagtttcagattttggtcttagtcgttttaataccgccgataattta
gaaacactcagtaagattcgtggtacctttgcctattgttcacctgaagtcgccgtaggt
aatggtagtctctacactaccaaatctgatatctacagtattggtatcgtcttttgggaa
ttagtaactcgtgttatcaatggtgaatactctcgtccctacagtgaatattctcacatc
aaaatggactttcaaatcatgttaaactcaaaggaaggtttaagaccaaccttacctcaa
aatactccacctggtcttgaagcactctacaaacaatgtgtaaaccaagaacaaacctta
agaccaagttgcgaagaaatcattgaaactttaaatcgattgagacatgaatatatgtct
tcaaaaactacttgggattctttaattagaaaactaccatctttatcaccaccacctcaa
ccaactactacaacaacaactactacttcttcttccacttcaacaaataatataaataat
aacataaataataacaataatacttaa

DBGET integrated database retrieval system