KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279667
Entry
DDB_G0279667      CDS       T00245                                 

Gene name
H2AX
Definition
(RefSeq) histone H2A
  KO
K11251  histone H2A
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0279667 (H2AX)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0279667 (H2AX)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    DDB_G0279667 (H2AX)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0279667 (H2AX)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 8622161
NCBI-ProteinID: XP_641587
dictyBase: DDB_G0279667
UniProt: Q54WG6
Position
3
AA seq 154 aa
MSETKPASSKPAAAAKPKKVIPRVSRTGEPKSKPESRSARAGITFPVSRVDRLLREGRFA
PRVESTAPVYLAAVLEYLVFEILELAHNTCSISKKTRITPQHINWAVGNDLELNSLFQHV
TIAYGGVLPTPQQSTGEKKKKPSKKAAEGSSQIY
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtcagaaaccaaaccagcctcatccaaaccagccgctgctgccaaaccaaagaaagtc
attccacgtgtaagcagaacaggtgaaccaaagagcaaaccagaatcacgttcagctcgt
gccggtatcactttcccagtatctcgtgttgatagattattacgtgaaggtagattcgct
ccacgtgttgaaagtaccgcaccagtctatttagctgccgtccttgaatatttagtattt
gaaattttagagttagctcacaatacttgttcaatcagtaaaaagacccgtatcacacca
caacacatcaactgggccgtcggtaatgatcttgaattaaattctctcttccaacacgtt
accatcgcctacggtggtgttttaccaactccacaacaatccaccggtgaaaagaagaag
aaaccatcaaagaaagcagctgaaggttcatctcaaatctattaa

DBGET integrated database retrieval system