KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279675
Entry
DDB_G0279675      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Vanin_C CN_hydrolase
Other DBs
NCBI-GeneID: 8622166
NCBI-ProteinID: XP_641592
dictyBase: DDB_G0279675
UniProt: Q54WG1
Position
3
AA seq 540 aa
MNIKKSKQQLFFVVFLIFIIILTLLGFVKGNNDDDDYYIGAVLEYTPPEYNFKDPNETPI
KYVLANVKRYNSYVQIAKSQGAQIIVFPEYGLLGNAFATRDQVLPYLEVIPDPHQSSQPI
IPCNNEDFDNRTILQSLSCIAIQNSIVLVADMGDVQYCDNSTSINNNDNNNNCPADGRFQ
YNTQVAFSEKGELLAKYHKSHLYSEPYFNPSSPPDPVIFSTNFNVTFGMFICFDILFEEP
QKTLIQKYGIHNLVYSTQWVNVNYAYARGIQESWSKLYNANVLAANIGATSAISGSGIYS
NGNFINTFQNPTTKPANKLLVGKLPKDPTTTTTTTTTTTKSSSSNNKINSGIEAIDFVNY
KPFKQYDGDGVNLNDVKTPTSINATIIPFLISENQVNKTIISENNGFSCTFTYSTSDRID
KNRLLYSLVSFNGNFNDFFNSQLCSASICASNDPNSCFDNVFDSSSTFTSLHIQGNFQSD
YHIVPTFTTYPLIDNYLSNYQFGDQFISVSNIEQYFVGTSLFAIQWNDTSSSDNLSYEYI
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgaatattaaaaaatctaaacaacaattattttttgttgtttttttaatattcattata
attttgacacttttaggatttgtaaaaggtaataatgatgatgatgattactatattgga
gcagtattagagtatacaccaccagaatataattttaaagatccaaatgaaacaccaatt
aaatatgttttagcaaatgttaaacgatataattcatatgtacaaatagcaaaaagtcaa
ggagcacaaattatagtattcccagagtatggtttattaggtaatgcatttgcaacaaga
gatcaagtattaccatatcttgaagttataccagatccacatcaatcttcacaaccaatt
ataccatgtaataatgaggatttcgataatagaactattttacaaagtttaagttgtatt
gcaattcaaaattcaattgtattggtagcggatatgggtgatgtacaatattgtgataat
agtacatcaattaataataatgataataataataattgtccagctgatggtagatttcaa
tataatacacaagttgcattctcagagaaaggtgaattattagctaaatatcataaatct
catttatatagtgaaccatattttaatccatcatcaccacctgatccagttatattttca
acaaatttcaatgttacatttggtatgtttatttgtttcgatattttatttgaagaacca
caaaaaactttaattcaaaagtatggaattcataatttagtttactctactcaatgggta
aatgtaaattatgcatatgcacgtggtattcaagaatcttggtcaaaactttacaatgca
aatgttttagctgcaaatattggtgcaactagtgcaatcagtggttctggtatttattct
aatggtaatttcattaatacttttcaaaatccaactacaaaacctgcaaataaattatta
gttggtaaattaccaaaagatccaacaacaacaacaacaacaacaacaacaacaacaaag
tcgtcttcatcaaataataaaattaattcaggtattgaagcaatagattttgttaattat
aaaccatttaaacaatatgatggtgatggtgttaatttaaatgatgtcaagacaccaact
agtattaatgcaactattataccatttttaattagtgaaaatcaagttaataaaactata
attagtgaaaataatggtttttcatgtacttttacctatagtacaagtgatagaatcgat
aagaatcgtcttttatattcattggttagttttaatggtaattttaatgatttctttaat
tctcaactttgtagtgcttcaatttgtgcttcaaatgatccaaatagttgttttgataat
gttttcgattcttcttcaacttttacctcattacatattcaaggtaattttcaatcagat
tatcatatagttccaacatttacaacatatcctttaattgataactatttatcaaattat
caatttggtgatcaattcatttcagtctcaaatattgaacaatattttgttggtacaagt
ttatttgcaattcaatggaacgatacttcaagtagtgataatcttagttatgaatatatt
taa

DBGET integrated database retrieval system