KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279795
Entry
DDB_G0279795      CDS       T00245                                 

Gene name
adamts
Definition
(RefSeq) a disintegrin-like and metallopeptidase with thrombospondin type 1 motif
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Motif
Pfam: TSP1_ADAMTS TAXi_C TSP_1 TSP1_CCN
Other DBs
NCBI-GeneID: 8622232
NCBI-ProteinID: XP_641492
dictyBase: DDB_G0279795
UniProt: O15916
Position
3
AA seq 724 aa
MKIKSLIILIITILFLKKINSAFVYPRPSELTPIKLKPIISIGNFCPYKNYGVQLTINKI
NYNLVIDTVNSVTTLSSKECRYGCLRLPRLYIPSSKTKVDKEISKGYYKDSTVWQGYVVG
EKIIINHNLTTKSEIKMIALTSQSKPPANPICESSSMLAHGIIGVGQSKEINSFVRQFSG
MNNIPPIFSLTMCPENPRIWFGGYDPSVLEEPKKFAFTRSEGDSYGFTINNVYIGPNTLY
QVTDFVWKSELDTSTPFIHLPSSVFHQAIQVLSRERHFNKYFNTRFFTEKKCVLNPLANF
TIDQINGLLPKFRIVFKSNLPNSEISLDAVPSYLVIEGDKACPGIVESLDYNSRFGVSLF
QQYMVLFDQVNGLVAMGRASCKPNRWVPGSNWGECKRDLNSTDIREGGINCEMQTRPLKC
INGRNKRVADSLCHGIFKPLYKRPCYKEEESSEHHNDNSSSSHHPSIFVDNDDDDQNENS
PPPATKNGKKITPKPVRTKKPTTDCKVDIGTWKVMGNWSDCDQICGSGLQTREVLCISIN
GELLDQERCNSHTKPPSERVCAVAKCQAEYHWDTSDWSGCSTQCGEGTQSRFSTCIDSSV
WRNVDSLNCKGPMPILERECLGQPLCSKFKWDWEPCQPSCPEMAYVYCYNSSSATKVDNS
FCKQIPNLFIPIDCKCYKTKKHLQTTSTSEFSDSTSNSSKLILPLISLNIIYSILILFIT
IKLI
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgaaaatcaaaagtttaataattttaataataacaatattatttttaaaaaaaataaat
tcagcatttgtttatccgagaccttccgaattaacaccaattaaattaaaaccaattatt
tcaattggtaatttttgtccttacaaaaattatggtgttcaattaacaataaataaaatc
aattataatttggttattgatacagtaaattctgtaacaacattatcatcaaaagaatgt
agatatggatgtttacgtttacctagattatatattccaagttcaaaaacgaaagttgat
aaagaaatttcaaaaggatattataaagattcaacagtatggcaaggttatgttgttggt
gaaaaaattattattaatcataacttaacaacaaaatctgaaattaaaatgattgcatta
acatcacaatcgaaaccacctgcaaatccaatttgtgaatcatcaagtatgttagcacat
ggtataattggtgttggtcaatcaaaagaaattaattcatttgttagacaattttcaggt
atgaataatataccaccaatattttcattaacaatgtgtccagagaatccaagaatttgg
tttggtggatatgatccaagtgttttagaagaaccaaaaaagtttgcatttacaagatca
gagggtgactcatatggatttacaattaataatgtttatattggaccaaatacattatat
caagttacagattttgtatggaaatctgaattggatacaagtacaccattcattcattta
ccatcatcagtttttcatcaagcaattcaagttttatcaagagagagacattttaataaa
tattttaatactcgtttctttactgaaaagaaatgtgtactaaatccacttgcaaacttt
acaattgatcaaattaatgggttattaccaaaatttagaattgtttttaaatcaaatttg
ccaaactctgaaatctctttagatgcagtaccatcctatttggtaattgaaggtgataaa
gcatgccctggtatagttgagtcattggattataattcaagatttggtgtttcattattt
caacaatatatggttttatttgatcaagtcaatggtttagttgcgatgggtagagcaagt
tgtaaaccaaatcgttgggtacctggtagtaattggggtgaatgtaaaagagatttaaat
tcaactgatattagagaaggtggtataaattgtgaaatgcaaactcgtccattaaaatgt
ataaatggtagaaataaacgtgttgctgattctctttgtcatggtatttttaaaccactc
tacaaaagaccatgttataaagaagaagaatcatctgaacatcataatgacaattcttca
tcaagtcatcatccatcaatatttgttgataatgacgatgatgatcaaaatgaaaattca
cctccaccagcaactaaaaatggtaagaaaataacaccaaaaccagttagaactaaaaaa
ccaacaacagattgtaaagttgatattggtacttggaaagtaatgggaaattggtctgat
tgtgatcaaatttgtggttcaggtttacaaactagagaggtactttgtatttcgatcaat
ggtgagttattagatcaagaaagatgtaattctcatactaaaccaccaagtgaacgtgtt
tgtgcagttgcaaaatgtcaagctgagtatcattgggatacttcagattggtcaggttgt
tcgactcaatgtggtgaaggtacacaaagtcgtttttcaacatgtatagattcatcagtt
tggagaaatgttgattcattaaattgtaaaggtccaatgccaattcttgaaagagaatgt
cttggtcaaccattatgtagtaaattcaaatgggattgggaaccttgtcaaccaagctgt
ccagaaatggcttatgtctattgttataactcttcatcagctacaaaagttgataattca
ttttgtaaacaaattccaaatctattcattccaatagattgtaaatgttataaaacaaaa
aaacatttacaaacaacttcaacttctgaattctctgacagtacttcaaattcttcaaaa
ttaatattacctttaatttcattaaatattatttattcaattttaattttatttataaca
ataaaattaatttaa

DBGET integrated database retrieval system