KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279909
Entry
DDB_G0279909      CDS       T00245                                 

Gene name
lipA
Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Lipoxygenase
Other DBs
NCBI-GeneID: 8622298
NCBI-ProteinID: XP_641415
dictyBase: DDB_G0279909
UniProt: Q54W35
Position
3
AA seq 629 aa
MANFLIYDGASTYNPFDYEYPINKINNNPKTFKFPPKHSVCLPQKDHFIVERQLALETKQ
YTYNFEHNVRVAGFDTPVVGLPPCFKYMAPTYELPKCEQLMNPSFAAHGFSLLFSDFQAK
INNYLTNKKSEYFGSVSEYLKMIMLPNPPKLIENQTIESLNKFEWLNDKEFGRQRLQGLN
AGQLIRLTNEKVQELDLFNKLKFEKMLPTFNMILSSEVNSNFQKMLDNGNLYMVDYSIFD
DVNYYESAKKRGRYISSPIALFYINENDEKLYPLCIKILQNDELSPVFTPASNPPESWIF
AKLWFQSADGQHMEFFTHLYECHLLGEVFTIATHRQLSTSHPIYQLLHPHFDLLLDINHR
ARGNLLSSFGPIESLLGGGSIAALHLIVKYHKNFIWRDNTFLNRLKKNNTLNDNKNRKYY
FKEDGIEIYKNLFGFVQDVLSKFYTSKEDIERDFELHSWVDEITSEHGGTIKGLIEGEKL
VELTQVVELVTDIIFRVTVEHSIGNHGQWDMFGFTPNVPGALYMDPHKIIEGIPTTFEMI
INSLPPKKETQDQIAITHLLANTDTGLPTFISTIYEFEKDQSAPNFKDICSSYRSKMEHL
STIIENRNKNVNMPYSYMDPSKICGSIYI
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggcaaattttttaatatatgatggagcttcaacttataatccatttgattatgaatat
ccaattaataaaataaataataacccaaaaacatttaaatttcctccaaaacattcagtt
tgtctaccacaaaaagatcatttcattgttgaaagacaattggcattagaaacaaaacaa
tatacatataatttcgaacataatgttagagtagccggatttgataccccagtggttggt
ttaccaccatgtttcaaatatatggcaccaacatatgaattaccaaaatgcgaacaatta
atgaatccaagttttgctgcacatggatttagtttattattttcagattttcaagcaaaa
attaataattatttaacaaataaaaaaagtgaatattttggatcagtatcagaatattta
aaaatgataatgttaccaaatccaccaaaattaatagaaaatcaaacaattgaaagttta
aataaatttgaatggttaaatgataaagaatttggtagacaaagattacaaggtttaaat
gctggtcaattaattaggttaacaaatgaaaaagttcaagaattagatctttttaataaa
ttaaaatttgaaaagatgttaccaacatttaatatgattctttctagtgaagttaatagt
aatttccaaaagatgcttgacaatggtaatttgtatatggttgattattcaatatttgat
gatgtaaattattatgaatctgccaagaaaagaggtcgttacatttcaagtccaatagca
ttattctatatcaatgaaaatgatgaaaaactatatccactttgtataaagattttacaa
aacgatgaattgtcaccagtgtttacacctgcttccaatccaccagaatcttggatattt
gctaaactttggttccaatctgctgatggtcaacatatggaattctttactcatctttac
gaatgtcatttattaggtgaagttttcacaattgcgacccatcgtcaactttcaacttct
catccaatctatcaattgttacatcctcatttcgatcttttacttgatataaatcataga
gcaagaggtaatttactttcaagttttggtccaattgaatctttattaggtggtggttca
attgctgcacttcatttaattgtaaaatatcataaaaatttcatttggagagataataca
tttttaaatagattaaaaaaaaataatacattaaatgataataaaaatcgaaaatattat
tttaaagaagatggtattgaaatttataaaaatttatttggatttgttcaagatgtatta
tctaaattttatactagtaaagaagatattgaaagagattttgaattacattcatgggtt
gatgaaataacaagcgaacatggtggcacaattaaaggattaattgaaggtgaaaaatta
gttgaactaactcaagtggttgaattagttaccgatataatatttcgtgtaactgttgaa
cattcaattggtaatcatggtcaatgggatatgtttggttttaccccaaatgtaccaggc
gctctctatatggatcctcataaaatcattgaaggtataccaacaacatttgaaatgatc
ataaattcattaccaccaaagaaagaaactcaggatcaaattgcaatcactcatctttta
gcaaatactgatactggtttaccaacttttatctctacaatttatgaatttgaaaaagat
caatcagctccaaattttaaagatatttgttcctcctatagatcgaaaatggagcattta
tcaacaattatcgaaaatcgtaacaaaaatgtaaatatgccatactcttatatggatcct
tcaaaaatttgtggttcaatttatatttaa

DBGET integrated database retrieval system