KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279925Help
Entry
DDB_G0279925      CDS       T00245                                 

Gene name
mlkA
Definition
(RefSeq) CAM kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddi01001]
    DDB_G0279925 (mlkA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     DDB_G0279925 (mlkA)
Protein kinases [BR:ddi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   DDB_G0279925 (mlkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH Pkinase_fungal Vps52 RIO1
Motif
Other DBs
NCBI-GeneID: 8622308
NCBI-ProteinID: XP_641424
dictyBase: DDB_G0279925
UniProt: P25323
Position
3
AA seq 295 aa AA seqDB search
MTEVEKIYEFKEELGRGAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILK
KVNHPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGY
LHGLNIVHRDLKPENLLLKSKENHLEVAIADFGLSKIIGQTLVMQTACGTPSYVAPEVLN
ATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQIMEANYEFPEEYWGGISKEAKD
FIGKLLVVDVSKRLNATNALNHPWLKSNNSNNTIDTVKMKEYIVERQKTQTKLVN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtagaaaaaatatacgaatttaaagaggaacttggaagaggtgctttttca
attgtatatcttggtgaaaataaacaaactaaacaaagatatgcaatcaaagttatcaat
aaatcagaattgggtaaagattatgaaaagaatttaaagatggaggttgatatcttaaag
aaagttaaccacccaaatattatcgcattaaaagagttattcgatactccagagaaatta
taccttgttatggaacttgttacaggtggtgaattatttgataaaattgttgaaaaaggt
tcatattcagaagcagatgccgccaatttagttaaaaagattgtttcagctgttggatac
cttcatgggttaaatatcgtccacagagatttaaaaccagaaaatttacttttgaaatct
aaagaaaaccatttggaagttgctattgctgattttggtcttagtaaaattattggccaa
actcttgtaatgcaaactgcatgtggtacaccaagttatgttgcaccagaggtattgaat
gcaactggttatgataaggaagttgatatgtggagtattggtgtcatcacttatatttta
ttatgtggtttcccaccattctacggtgatacagtcccagaaatctttgaacaaattatg
gaagccaactatgaattcccagaagaatattggggtggtatctctaaagaagccaaagac
tttattggaaaattattagttgttgatgttagcaaaagattaaatgctaccaatgctctc
aatcatccttggttaaagtccaataactcaaataacaccattgatactgttaaaatgaaa
gaatacattgttgaaagacaaaaaactcaaacaaaattggttaactaa

DBGET integrated database retrieval system