KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279959
Entry
DDB_G0279959      CDS       T00245                                 

Gene name
eco1
Definition
(RefSeq) GCN5-related N-acetyltransferase
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0279959 (eco1)
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     DDB_G0279959 (eco1)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    DDB_G0279959 (eco1)
SSDB
Motif
Pfam: Acetyltransf_13 zf-C2H2_3 Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 DUF2441 CENP-B_dimeris
Other DBs
NCBI-GeneID: 8622309
NCBI-ProteinID: XP_641425
dictyBase: DDB_G0279959
UniProt: Q54W25
Position
3
AA seq 441 aa
MEMFTLLKDSSISPTPSSTSSSSSSSSSTFFSNCKRKSISSSSSPSTMTTKTMNILPANK
KLPALQIVPDKDNCENESDQEIELNKCNKKLKLTSPPPSEQQQQQQQQQPEVSKSQPIDN
FKMYKEIQEKHVKEWDWKAAAQVHYSDNVHSKFLKPSTKSTNKSTNKSSSSSSSKSQTSI
TTAVSTTIASTTPILEQTVIDAGQKNVGQMVCSKCKMLYSYGSKEDEAAHQSFCNGNIQQ
QKVIIKNWQSMKIVNTFPNGRSIIVVTKDNISNNSALSSKINLLKEIINIELGYASPSPS
PSSNVHNNNKNKNDNDNDNDNDDDDNEEKLFLYLDSNGRVLGCLIAERVEKGYKIESSSP
TIQCSKVPTKILCGINRIWVLPSSRKRGIASKLMESLASNMYYCYHLKKHEIATTQPSTT
GLLFFNNYFKTNQFLLYNINQ
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggaaatgtttacattactaaaagatagttcaatttcaccaaccccatcttcaacatca
tcctcaagctcatcttcatcgtcaacattttttagtaattgcaaaagaaaatcaatctca
tcatcgtcatcaccatcaacaatgacaacgaaaacaatgaatattttaccagcaaataaa
aaattacctgcacttcaaattgttccagataaagataattgtgaaaatgaaagtgatcaa
gaaattgaattaaataaatgtaataaaaaattaaaactaacttcgccaccaccatcagaa
caacaacaacaacaacaacaacaacaaccagaagtaagcaaaagccaaccaatagataat
tttaaaatgtataaagaaatccaagagaaacacgtaaaagaatgggattggaaagctgct
gcacaagttcactattccgataatgttcactcaaaattcttaaaaccatcaactaaatca
accaataaatcaaccaataaatcatcatcatcatcatcatcaaaatcacaaacctcaatt
acaacagcagtatcaacaacaatagcatcaacaacaccaattttagaacaaacagttata
gatgcaggtcaaaaaaatgttggtcaaatggtatgtagtaaatgtaaaatgctttattca
tatggctctaaagaagatgaagcggcacatcaatcattttgtaatggcaatattcaacaa
caaaaagtgataatcaagaattggcaatccatgaaaattgtaaacactttccccaatggt
cgatccattatcgtagttacaaaagacaacatttcaaacaactctgcactatcttcaaaa
attaatctattaaaagaaattataaatattgaattaggctatgcatcaccatcaccatca
ccatcatcaaatgtacataataataataaaaataaaaatgataatgataatgataatgat
aatgatgatgatgataatgaagagaagttatttttatatttggattcaaatggtagagtt
ttgggttgtttaattgcagaaagagttgaaaaaggttacaagattgaaagttcttcacca
acaatacaatgttcaaaagtaccaacaaagattctatgtggaattaatcgtatttgggtt
ttgccatcatcaagaaaacgtggaatcgcttcaaaactaatggaatctttagcttcgaat
atgtattattgctatcatttaaagaaacatgaaattgcaacaactcaaccttcaacaact
ggtcttttattctttaataattattttaaaacaaatcaatttttattatataatattaat
caataa

DBGET integrated database retrieval system