KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280345
Entry
DDB_G0280345      CDS       T00245                                 

Gene name
sgtA
Definition
(RefSeq) tetratricopeptide-like helical domain-containing protein
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0280345 (sgtA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0280345 (sgtA)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 SGTA_dimer TPR_7 TPR_14 TPR_12 TPR_17 TPR_19 TPR_10 TPR_6 TPR_15 TPR_16 TPR_9 BTAD PPR DUF2884 TPR_21 Csm2_III-A TOM20_plant DUF5113
Other DBs
NCBI-GeneID: 8622525
NCBI-ProteinID: XP_641391
dictyBase: DDB_G0280345
UniProt: Q54VG4
Position
3
AA seq 334 aa
MASNKQKLAVSILNFLKVSMKEDAENAESLQVAVECIRDVFGVDENDSTLQVSAPLSEIF
DKFIGENNTNTTTTTTTTTTKLSKEELLNQTYSEIPYELLESFKQFITILEQKGAFANED
SCETVIKATKQKFMESKAGEVKAIAEKLKNEGNAKLNEGKHQEALSCYNKAILYDNTNAI
YFANRAATYSALQNFEKSIEDCLEAIKRNPNYGKAYTRMGSAYTSLGKFSEAMEAYNKAI
ELEPNNETFKASLANAERLAAAANNQAPAMPNIPGMPDLGGLDFGSLLSNPAIRGLANNL
MSDPKMKEMMDNGDMASLLNNPDLLKMFGNLGKK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcatcaaataaacaaaaattagcagttagtattttaaactttttaaaagtatcaatg
aaagaagatgcagagaatgctgaaagtttacaagttgcagtcgaatgtattagagatgtt
ttcggagtagatgaaaatgattcaactttacaagtttcagcaccattatctgaaattttc
gataaattcattggtgaaaataataccaataccaccaccaccaccactaccaccactaca
aaactttcaaaagaagaattattaaatcaaacttatagtgaaatcccatacgaacttctt
gaatcatttaaacaatttatcacaattcttgaacaaaaaggtgcttttgcaaatgaagat
tcatgtgaaacagttattaaagcaacaaaacaaaagttcatggaaagtaaagcaggtgaa
gttaaagctattgctgaaaaattaaagaatgaaggtaatgctaaattgaatgaaggtaaa
catcaagaagcactttcatgttacaataaagcaattctttatgataacaccaacgctatt
tactttgcaaatagagctgccacttattctgctttacaaaactttgaaaaatcaattgaa
gattgtcttgaagcaattaaaagaaatccaaattatggtaaagcatacactagaatgggt
tctgcatatacatcattaggtaaattctcagaagcaatggaagcatataataaagcaatt
gaattagaaccaaataatgaaacttttaaagcatcacttgccaatgctgaaagacttgct
gctgctgcaaacaatcaagcaccagctatgccaaatattccaggtatgccagatttaggt
ggtttagattttggttcactcttaagtaatccagcaattagaggtttagcaaacaactta
atgtctgatccaaaaatgaaagaaatgatggataatggtgatatggctagtcttctcaat
aatccagatttattaaaaatgtttggtaatttaggtaaaaagtaa

DBGET integrated database retrieval system