KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280371Help
Entry
DDB_G0280371      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00561  Glycerolipid metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DDB_G0280371
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DDB_G0280371
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0280371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-GeneID: 8622399
NCBI-ProteinID: XP_641267
dictyBase: DDB_G0280371
UniProt: Q54VT8
Position
3
AA seq 539 aa AA seqDB search
MKPYIGAIDQGTSSTRFILFDKNGDIVLSHQILLTQHHPHPGWVEHDGNEILESVNKCIQ
VVMKQYYENNFGTKEDIKAIGITNQRETTIVWDKKTSKPLNNAIVWCDTRTKDLVNYFNN
KAKKLIDDNNIIDNNSKSTTVVDGAQGECKLESKNYLREKCGLPLSSYFSGLKLKWLFDN
CESVREAYGRGDCLMGTIDSWLVWNLTGGKCHITDVTNASRTMLMNLKTLSWDKELCDFL
EVPIEILPNIHSSSEIYGHVTMGDDEQQQQQHPLHGIPIAGVLGDQQAAMVGQMCFEKGQ
AKNTYGTGCFLLYNTGNDIVHSRNGLLTTVCYQFGKDSPPIYALEGGVAVAGSGVRWLID
NMGIAESSQEIEDLAKSVQDTGGMYFVPAFSGLFAPYWRDDARGVMVGLTHHTNRCHIAR
SVLESTCLQTFEVLDAMQKDSGNKLVELRVDGGMAKNNLLLQIQSDLLGLPVVKPISLET
TCFGAAFAAGIATGVWKETMQFKIGGKFTPQLDENHKTQKLKEWKKAISKSLDWIDTKN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatatattggagcaattgatcaaggtacatcaagtacaagatttatacttttc
gataagaatggagatatagtattatcacatcaaatattattaacacaacatcatccacat
ccaggatgggttgaacatgatggtaatgaaatattagaatctgttaataaatgtattcaa
gttgtaatgaaacaatactatgaaaataattttggtacaaaagaagatattaaagcaatt
ggtataaccaatcaaagggagacaactatcgtatgggataagaagacatcgaagccatta
aacaatgccatagtttggtgtgatacacgtactaaagatttagtaaactattttaataat
aaagcaaagaaattaattgatgataataatataatagataataatagtaaatcaactaca
gtagttgatggtgctcaaggagaatgtaaattagagagtaagaattatttacgtgaaaaa
tgtggattaccattaagttcttattttagtggattgaaattgaaatggttatttgacaat
tgtgaatcggttagagaggcatatggacgtggtgattgtttaatgggtaccattgatagt
tggttggtttggaatttaacaggtggtaaatgtcatattacagatgttaccaatgcaagt
agaaccatgttaatgaatttgaaaactttatcatgggataaagaattatgtgatttctta
gaagtaccaatagagattttaccaaacattcatagttcttcagaaatatatggtcatgtg
acaatgggtgatgatgagcagcagcagcagcagcatccattacatggtataccaattgca
ggtgttttaggtgaccaacaagctgcaatggttggtcaaatgtgttttgagaagggtcaa
gctaaaaatacatatggtactggctgtttcttgttatataatactggtaatgatatagta
cattcaagaaatgggttgttaactacggtttgttatcaatttggtaaagattcaccacca
atttatgcattggagggtggtgtagctgtggcaggttctggtgtacgttggttgattgat
aatatgggtattgcagagagtagtcaagagattgaggatttggcaaagagtgtacaagat
actggtggtatgtattttgtacctgcttttagtggattattcgcaccttattggagagac
gatgcaagaggtgtaatggttggtttaactcatcataccaatcgttgtcatatagcaaga
tctgtattggagtcaacttgtcttcaaacatttgaagttttagatgcaatgcaaaaagat
tcgggaaataaattggtagagttacgtgttgatggtggtatggctaaaaataatttactc
ttgcaaattcaatcagatttacttggtttaccagttgtaaaaccaataagtttagaaact
acttgttttggtgctgctttcgctgctggtattgcaactggtgtttggaaagaaactatg
caatttaaaattggtggtaaattcactccacaattagatgaaaatcataaaactcaaaaa
ttaaaagaatggaaaaaagcaatttcaaaatctttagattggattgatacaaaaaattaa

DBGET integrated database retrieval system