KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280437
Entry
DDB_G0280437      CDS       T00245                                 

Name
(RefSeq) Ras GTPase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 8622554
NCBI-ProteinID: XP_641174
dictyBase: DDB_G0280437
UniProt: Q54VD5
Position
3
AA seq 298 aa
MSSFTKNKLSNFANTNNQIIKIDMVVLGSGAVGKTALTVQFHQQYFIHEYDPTIEDSYTK
NCRIDNDNYSLNILDSAGNEDYTAIRDQYLKNSDGFLIVYDISDRVSFEKTSELVDQIKM
VKDVESFPMVLIGNKCDLDSEGQRKVSLTEGNDLSKFYGCPFFETSAKTTLNVESSFFQL
VREIQRFEQFEKEKQLEREKKKLKNLNNNNNNNNNNNNNNNNSNRTNSFNSIGRKNKVKF
DLNNNNNNKDDYNENNNNKGGNDKKKSEINNSKACGPKKSFKQKIFTSFSCIHGGTNS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagttcattcacaaaaaataaattaagtaattttgcaaatacaaataatcaaataata
aaaattgatatggttgttcttggtagtggtgctgttggaaaaacagcattaacagttcaa
tttcatcaacaatattttattcatgaatatgatccaacaattgaagattcttatacaaag
aattgtagaattgataatgataattattcattgaatatattagattcagctggaaatgaa
gattatactgcaatacgtgatcaatatttaaaaaactctgatggatttttaatagtttat
gatataagtgatagagttagttttgaaaaaacaagtgagttagttgatcaaattaaaatg
gttaaagatgttgaatcatttccaatggtattaattggtaataaatgtgatttagattca
gaaggtcaaagaaaagtttcattaactgaaggtaatgatctttcaaaattctatggttgt
ccattctttgaaacttctgctaaaacaacattaaatgttgaatcttcattttttcaatta
gttagagaaattcaacgttttgaacaatttgaaaaagaaaaacaacttgaaagagaaaaa
aagaaattaaaaaatttaaataataataataataacaacaacaacaacaataataataat
aataactcaaatagaacaaatagttttaatagtattggtagaaaaaataaagtaaaattt
gatttaaataataataataataataaagatgactataatgaaaataataataataaaggt
ggaaatgataagaaaaaatcagaaattaataattcaaaagcatgtggacctaaaaaaagt
tttaaacaaaaaatttttactagtttttcatgtatacatggtggaacaaatagttaa

DBGET integrated database retrieval system