KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280553
Entry
DDB_G0280553      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Other DBs
NCBI-GeneID: 8622604
NCBI-ProteinID: XP_641046
dictyBase: DDB_G0280553
UniProt: Q54V85
Position
3
AA seq 297 aa
MLVTYNGHVDDNSINNQIIENNVQTDDLNNSFDNHKDQIELKSYKETENIETENIETENK
EVETINNEIIKISQEIEISKSQEIDKTNNNINEQNNDNFEIPEKELQEIEACPCNKNIII
NDSNNYNVTIIQNDDSIVIENCTDCGDHITPKEEEEKEKEKEKEKEKEKEKEKEKEKDSE
ESLQEQCLNKENESIDNDNNNNIINNNNNDSIIIIKESTDDKKEIPSIECIQNNQNNQNN
NDSPINKEIEDDNNNNIEKDGADIHIKEEQVEKVQVEEKEVEEIQVKEMKNIKMVNQ
NT seq 894 nt   +upstreamnt  +downstreamnt
atgttagtaacatataatggccatgttgatgacaattcaataaataaccaaataattgaa
aataatgttcaaacagatgatttaaataattcttttgataatcataaagatcaaattgaa
ttaaaatcatataaagaaacagaaaatatagaaacagaaaatatagaaacagaaaataaa
gaagttgaaacaattaataatgaaataattaaaatttctcaagaaattgagatttcaaaa
tcccaagaaattgataaaacaaataataatattaatgaacaaaataatgataattttgaa
attccagaaaaagaactacaagaaattgaagcttgtccttgtaataaaaacattatcatt
aatgatagtaataattacaatgttactatcattcaaaatgatgattcaattgtcatagag
aactgtacagattgtggtgatcatattactccaaaagaagaagaagaaaaagaaaaagaa
aaagaaaaagaaaaagaaaaagaaaaagaaaaagaaaaagaaaaagaaaaagactcagag
gaatcacttcaagagcaatgccttaataaagaaaatgaaagtatagataatgataataat
aataatatcatcaacaacaacaacaatgattctattataattattaaagagtccacagat
gataaaaaagaaattccatcaatagaatgcattcaaaataatcaaaataatcaaaataat
aatgattctccaattaacaaagaaattgaagatgataataataataatattgaaaaagat
ggagccgatattcatattaaagaagaacaagtagaaaaagtccaagtagaggaaaaagaa
gtggaagaaattcaagtaaaggaaatgaaaaacatcaaaatggtcaaccaataa

DBGET integrated database retrieval system