KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280643
Entry
DDB_G0280643      CDS       T00245                                 

Name
(RefSeq) protein kinase, CMGC group
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 8622655
NCBI-ProteinID: XP_641096
dictyBase: DDB_G0280643
UniProt: Q54V35
Position
3:complement(3598294..3599733)
AA seq 442 aa
MDIYYILNHDNSDNNIFDFENNSDTIDIGKNYKKCNGQGQMLPPPTLITPSNQNDTITYY
TDGRSISVPRKMLIDPNTIVDCGTNGIMFIAFNFETQKRVILKKLSKRMFDNELNGHRII
RNLIFQNLFQGGKHISTYQSIFKRKCSDSYQPPLTSILNSIISSNDNPQQHSTLIQQKDD
EDFYFESIQPQYSLLNLISNNMLDQDDICQLFYEILMGLKFMHSAGVIHRDLDPENSIFV
DENFNIKFTEFNNCFLLDTDPTFLFNKEYITNTYSYRAPETIWGDSLYTEATDVWGAGVL
FAELLLGKRLFRSFNSKEHLKSIYKLIGAPKASEGAYVVKGELLFFLMEYNRKNSFQPTF
NNTFIGCNQIQIDLLKNMLCWDPRDRYSVNEILESPYFENIHDRTNFIPCDKNLNVNIHF
DILNLKPNQMTNLIDQEFLNPS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggatatttattatattctaaatcacgataattcagacaataatatttttgattttgaa
aataatagtgatactattgatattggtaaaaattataaaaaatgcaatggccaaggtcaa
atgttaccaccacctacattaataacaccatccaatcaaaatgatacaataacttattat
accgatggtcgttcaatctctgttccaagaaagatgctaattgatccaaatacaattgta
gactgtggcaccaatggtatcatgtttattgcttttaattttgaaactcaaaaaagagta
attttaaaaaaactatcaaaaagaatgtttgataatgaattaaatggccatagaattatt
agaaatttaatttttcaaaatcttttccaaggtggtaaacatatttcaacctatcaaagt
atttttaaaagaaaatgttcagattcatatcaacctccattgacatctattctaaattca
attataagttcaaatgataatccacaacaacattcaacattgattcaacaaaaagatgat
gaagatttttattttgaatcaattcaaccacaatattcattattgaatttaatatctaat
aacatgcttgatcaagatgatatttgccaattgttctatgaaattttaatgggtttaaag
tttatgcattctgccggagttatccatagagatttagatccagaaaactcaattttcgtt
gatgaaaattttaatattaaattcacagaatttaataattgctttctattagatactgat
cctacctttttattcaataaggagtatattactaatacttactcttatcgtgctcctgaa
acaatttggggtgattctttatatactgaagctactgatgtttggggtgctggtgtttta
tttgcagaactattgttaggtaaaagattatttagatctttcaacagtaaagaacatttg
aaatcaatttataaattaataggtgcaccaaaagcttcagaaggagcttatgttgtaaaa
ggagaattattgtttttcctaatggaatataatagaaaaaatagttttcaaccaacattt
aataatacatttataggctgtaatcaaattcaaattgaccttttaaaaaatatgctatgt
tgggatccaagagatagatattcagtcaatgaaattttggaaagtccatattttgaaaat
attcacgatagaacaaatttcattccatgtgataaaaatttaaatgttaatattcatttt
gatatcttaaatttgaaacccaaccaaatgacaaatttaattgatcaagaatttttaaat
ccaagttaa

DBGET integrated database retrieval system