KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280755
Entry
DDB_G0280755      CDS       T00245                                 

Gene name
ubqB
Definition
(RefSeq) ubiquitin/ribosomal protein L40 fusion protein
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03010  Ribosome
ddi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DDB_G0280755 (ubqB)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    DDB_G0280755 (ubqB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ddi03011]
    DDB_G0280755 (ubqB)
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0280755 (ubqB)
Ribosome [BR:ddi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    DDB_G0280755 (ubqB)
  Archaea
    DDB_G0280755 (ubqB)
Ubiquitin system [BR:ddi04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   DDB_G0280755 (ubqB)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Ubiquitin_5 TBK1_ULD Rad60-SLD_2
Other DBs
NCBI-GeneID: 8622722
NCBI-ProteinID: XP_641020
dictyBase: DDB_G0280755
Structure
PDB: 
6QKL 5AN9 5ANB 5ANC

Position
3
AA seq 128 aa
MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIEPSLVILARKYKCDKMICRKCYARLHPRAVNCRKKKCGHSNNL
RPKKKLLK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcaaatcttcgttaaaaccttaactggtaaaaccatcactctcgaagttgaaggttca
gacaacatcgaaaacgtcaaagccaagattcaagacaaagaaggtatcccaccagatcaa
caacgtcttatctttgccggtaaacaattagaagatggtcgtactttatccgattataac
atccaaaaggaatcaaccctccacttagttttaagattaagaggtggtattgaaccatcc
ctcgtcattcttgcccgtaaatacaaatgtgacaaaatgatttgcagaaaatgttatgct
cgtttacacccacgtgctgttaactgtcgtaagaagaaatgtggtcactctaacaattta
agaccaaagaagaagttacttaaataa

DBGET integrated database retrieval system