KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280969Help
Entry
DDB_G0280969      CDS       T00245                                 

Gene name
psmA4
Definition
(RefSeq) 20S proteasome subunit alpha-4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03050  Proteasome
Module
ddi_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    DDB_G0280969 (psmA4)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     DDB_G0280969 (psmA4)
Peptidases [BR:ddi01002]
 Threonine Peptidases
  Family T1: proteasome family
   DDB_G0280969 (psmA4)
Proteasome [BR:ddi03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    DDB_G0280969 (psmA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 8622914
NCBI-ProteinID: XP_640858
dictyBase: DDB_G0280969
UniProt: P34119
Position
3
AA seq 250 aa AA seqDB search
MARRYDQRTTIFSPEGRVYQVEYAMTAIRHAGATVGILAKDGIVLAAEKKTTAKLLDSST
SISEKMFKIDEHVVCAVAGITSDANILINYARLSSQRFFYQYQEPMPVEQLVSQICDTKQ
GYTQYGGLRPFGVSFLYAGWDRHYGFQLYQSDPSGNFAGWKATSIGGENSQVAQSVLRSN
YKPDISLKEALQLALKVLTKTMDRSNINSEKLEFSYFTKQGDNVVYHIFTAAELDAFIKE
TDLEQETEDN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagatatgatcaaagaacaacaattttttcaccagaaggtcgtgtttatcaa
gtagaatatgcaatgacagcaattagacatgcaggtgcaacagttggtattttagcaaaa
gatggtattgttttagcagcagagaaaaagaccacagcaaaacttttagattcatcaaca
tcaatctctgaaaagatgtttaagattgatgaacatgttgtttgtgcagtcgctggtatc
acatccgatgccaacattttaatcaattatgcaagattatcatcacaacgtttcttttat
caatatcaagaaccaatgccagtcgaacaattggtctctcaaatttgtgatacaaaacaa
ggttacactcaatatggtggtttacgtccatttggtgtctcattcctttatgctggttgg
gatcgtcattatggtttccaattatatcaatctgatccttctggtaattttgctggttgg
aaagctacctcaattggtggtgaaaatagtcaagttgcacaatcagttttaagatcaaat
tataaaccagatatttcattaaaagaagcccttcaattggctctcaaagttttaacaaaa
actatggatcgttcaaatatcaacagtgaaaaattagaattctcttatttcactaaacaa
ggtgacaatgttgtttatcatatttttactgcagcagaattagatgctttcattaaagaa
actgatctcgaacaagaaactgaagataattaa

DBGET integrated database retrieval system