KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280977Help
Entry
DDB_G0280977      CDS       T00245                                 

Gene name
abcC10
Definition
(RefSeq) ABC transporter C family protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 AAA_16 MMR_HSR1 RsgA_GTPase AAA_15 AAA_22 AAA_23 FtsK_SpoIIIE AAA_21 Dynamin_N Pex24p AAA_33 cobW AAA_27 DUF87 DUF2207
Motif
Other DBs
NCBI-GeneID: 8622997
NCBI-ProteinID: XP_640934
dictyBase: DDB_G0280977
UniProt: Q8ST87
Position
3
AA seq 1334 aa AA seqDB search
MKEIELDRPEEKKKKVKKEKKIGYGGKKSPEENSNFLSNLTFSWADGFVIHCFRNVLQLS
HLWDLASYDKSEYLAKKIAKSWEIEIQKPKPSYLRAGFRAFGKLQLLSIFLYAISVGIQF
VGPEILGRMVTFVVESKLGTSTEDPNMGYYYALIMFGTAMIGSFCTYHANRISFRTGDRL
RSIIVLDVYKKAIKLSNSARSDTSPGQIVNLMSNDAQRMVEVFGMFNNGALALPQIIICL
ALLYKKIGWPTFVGLGLMLAAIPFNGMAAKKLTETRKYLVSLSDSRVKATNEILQAIKII
KLYAWEDSFAKKVIEHRNNEIKLLFSYSRYRTILIVIISALPTAAAILVISSYYGHEKSL
DASRIFSALSYLNLLRLPLGFLPIIIALGIQMQIAGKRVTDFLLLPEMKDIQQIDNPSLP
NGVYMKNSTTTWNKLKEDSFGLKNINFEATGTSLTMVVGSVGSGKSTLVQAMLGELEIID
GEIGIKGSIAYVPQQAWIINATLKENIIFGKELDEERYQKVLEVCALKRDIELFPQGDSV
EIGERGINLSGGQKQRVSIARAVYSDADVYILDDPLSAVDSHVGKHLFHKCFKGILSSKT
VILVANQLNYLPFADNTVVLKSGEIVERGTYYELINSKLEFSSILEKYGVDENVISKKDD
IDEDEDEDQDTIEKVEIDLNKDEKSQPKSKSSNTDGTLISEEESEQGAVAGKVYWKYVTA
GGGLLFLVSMIFFLLETGSKTFSDWWLSHWQTESSERMESILLGEEPTGLTDDQNLGIYI
GLGMAAVFISVCKNFIYYEYSVYASRAIHHELFNALLKKPMYFFDQTPIGRIINRFTRDL
DGIDNLIATSISTFLTLMLTVIATIILVSIIVPFLLIPLAPISIIFFFLQYFYRYTSRGL
QRIEAITRSPIFNHFSETLNGVVSIRAYKKQQENILINQKRLDDNNNCYLTLQAMNRWLG
LRLDFLANLITFFACIFITIDKDTISPANVGLALGYALSLTGNLNYAALQAADTETKMNS
VERISQYIRGAVEAPQIIDDCRPSPDWPINGSIKFDNLVMRYREGLDPVLKGITCEIKAK
EKIGIVGRTGAGKSSIVLALFRLIEASEGSISIDGENIAKFGLKDLRRNLAIIPQDPVLF
SGTLRENLDPFNERSEEDLFSTIEDIQMSAVVKSLEGGLDSKVTENGENFSVGQRQLIVL
ARALLRKPKILVLDEATASVDGQSDSLIQATIRNKFSNCTILTIAHRLNTIMDSDRIMVL
DAGKISEFDEPWTLLQNQNGLLTWLVDETGPQNAIYLRKLAEAKKNGIDINEIMPIDNET
TPKDNINTPPPPPQ
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatagaactggataggccagaagaaaagaaaaaaaaagtgaaaaaagaaaaa
aagattggatatggcggtaaaaaatcaccagaagaaaattcaaactttttatcaaattta
acattttcatgggccgatggatttgtaattcattgttttagaaatgttttacaattatca
catctttgggatcttgcatcatatgataaatctgaatatttagccaaaaaaatcgcaaaa
tcatgggaaatcgaaattcaaaaaccaaaaccatcatatttaagggctggatttagagca
tttggaaaattacaattattaagtatttttttatatgcaataagtgttggaatccaattt
gttggaccagaaattttaggtagaatggttacatttgtagttgaatcaaaattaggaaca
tccacagaagatccaaatatgggatactattatgcattgattatgtttgggactgcgatg
attggttcattttgtacataccatgctaatagaatttcatttagaactggcgatcgttta
agatcaatcattgttttagatgtttataaaaaagcaattaaattatcaaattcagcaaga
tcagatacatcaccaggccaaattgtaaatttgatgagtaatgatgctcaaagaatggtt
gaagtatttggaatgtttaataatggcgcacttgcattaccacaaattattatttgtctt
gcattattatataaaaagattggttggccaacatttgtaggattgggtttaatgttagct
gcaattccattcaatggaatggctgcaaagaaattaactgaaactagaaaatatttagtc
tcactttcagatagtcgtgttaaagctacaaatgaaattttacaagctattaaaattata
aaattatatgcatgggaagatagttttgctaaaaaggttattgaacatcgtaataatgaa
attaaattattattttcatatagtcgttatagaactattttaattgttattattagtgct
ttaccaactgctgctgctattttagtaatttcatcatattatggacatgagaaatcttta
gatgcaagtagaatttttagtgcactttcatatttaaatttattaagacttccattaggt
ttcttaccaattataattgcattgggtattcaaatgcaaattgcaggtaaaagagttact
gattttctattattaccagaaatgaaagatattcaacaaattgataatccttcattacca
aatggtgtttatatgaaaaattcaacaacaacttggaataaacttaaagaagattcattt
ggtttaaaaaatattaattttgaagctactggaacatcattaacaatggttgttggttca
gtcggatcgggtaaatcaacattggtacaggcaatgttgggagagttagagattattgat
ggagaaatcggtattaaaggctcaattgcttatgtacctcaacaagcatggattatcaat
gcaacattaaaagagaatattatttttggtaaagaattggatgaagaaaggtatcaaaaa
gtattagaagtttgtgcattaaaacgtgatattgaattatttccacaaggtgattcagta
gaaattggtgaacgtggtattaacctttcaggtggtcaaaaacaaagagtttcaattgct
cgtgcagtatattcagatgcagatgtttatattttagatgatccattatcagcagtggac
tcacatgttggtaaacatttattccataaatgttttaaaggtattctatcaagtaaaaca
gttattttagtagcaaatcaattaaattatttaccatttgctgataatacagttgtatta
aaatcaggagaaatcgttgaaagaggtacctattatgaattaattaattctaaattagaa
ttttcaagtattcttgaaaagtatggtgttgatgaaaatgttatatccaaaaaagatgac
attgatgaagatgaagatgaagatcaagatactattgaaaaggttgaaatagatttaaat
aaagatgaaaagtctcaaccaaaatcaaaatcatcaaatactgacggaacattaatatca
gaggaagaaagtgaacaaggagctgttgcgggaaaggtatattggaaatatgtcacagct
ggtggtggtttattattcttggtttcaatgatattctttttattagaaactggttcaaaa
acattttcagattggtggttatcacattggcaaacagagtcatcagaaagaatggaatca
atattactaggtgaggaacctactggtttaactgatgatcaaaatttaggtatttatatt
ggtcttggtatggcagctgttttcatttcagtttgtaagaattttatttattatgaatat
tcagtgtatgcatcacgtgcaattcatcatgagttgttcaatgcattattaaagaaacca
atgtatttctttgaccaaacaccaattggtagaattataaatcgtttcactagagattta
gatggtattgataatttaatcgcaacttcaatatcaacatttttaactttaatgttaact
gtaattgcaactattatccttgtttcaatcattgttccattccttttaattccattggca
ccaattagtataatattcttctttttacaatacttttatagatatacatcaagaggttta
caaagaattgaagctattacacgttcaccaattttcaatcatttctctgaaactttaaat
ggtgtagtttcaattagagcatataaaaaacaacaagagaatatattaataaatcaaaaa
cgtttagatgataataataattgttatttaacactacaagcaatgaatagatggttaggt
ttgcgtttagattttttagcaaatttaattacattttttgcttgtattttcattacaatc
gataaggatacaattagtcctgcaaatgttggtttagcattaggttatgcactttcatta
actggtaatttaaattatgcagcacttcaagcagccgatactgaaactaaaatgaattca
gttgaacgtatttcacaatatattagaggagcagttgaagcaccacaaattattgatgat
tgtcgtccatcaccagattggccaataaatgggtcaattaaatttgataatttagtaatg
cgttatcgtgaaggattagatccagtattaaaaggtataacatgtgaaattaaagcaaaa
gaaaagattggtattgtaggccgtactggtgcaggtaaaagttcaatcgttttagcattg
ttccgtttaattgaagcttcagaaggttcaatttcaattgatggtgaaaatattgccaaa
ttcggattaaaagatttacgtagaaatttagcaatcattccacaagatccagtattattc
agtggtacacttcgtgaaaatttagatccattcaatgaacgttctgaagaggatttattt
tcaacaattgaagatattcaaatgagtgcagttgttaaatctttagagggtggtttagac
tcaaaagtaacagaaaatggtgaaaacttttcagttggacaaagacaattaattgtatta
gctcgtgcattattaagaaaaccaaagattttagttttagacgaagcaactgcctctgtc
gatggtcaaagtgattcattaattcaagcaacaattcgtaataagtttagtaattgtaca
attttaacaattgctcatagacttaatacaattatggatagtgataggattatggtactt
gatgcaggtaaaattagtgaatttgatgaaccatggacattattacaaaatcaaaatggt
ttattaacatggttagtagatgaaactggtcctcaaaatgcaatttatttacgtaaatta
gctgaagcaaagaaaaatggtatagatataaatgaaattatgccaattgataatgaaaca
actccaaaggataatatcaatacaccaccaccaccacctcaataa

DBGET integrated database retrieval system