KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281381
Entry
DDB_G0281381      CDS       T00245                                 

Symbol
dstA
Name
(RefSeq) signal transducer and activator of transcription family protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: STATa_Ig Dict-STAT-coil EF-hand_12 SH2
Other DBs
NCBI-GeneID: 8623045
NCBI-ProteinID: XP_640661
dictyBase: DDB_G0281381
UniProt: O00910
Structure
PDB: 
1UUS 1UUR

Position
3
AA seq 707 aa
MSSAEFSMDDFEDTFDSNATISTKDLFEGSDRLPLNQSINTTIQNLYLPNGGFAIGDQSQ
QQYYQAMPPLNQSDQFNLGRSNNLTPRTNQLQQLQQQQQQQQQPQQQQQQQTYGTQSPIH
MSQTPSSPLSSPLPSPTPFSRQQSYNNNNSNNTSSSQNYNNNNININNNNNNNNTNNNNN
NNNGNNSNGNNGNNNNNNNNNNNNNTNNNNNNNQQQQQQQQQQQQQQQQQQQQQQQGNPN
LSSPQPILDTIYKLLSEQEQTLVQMIHEQSLLLNRLPPTLDENSLAPLKSLSQKQITLSG
QMNTEMSALDATKKGMILEPTDLAKLFALKQDLQIQFKQLSLLHNEIQSILNPQHSAPKP
NVALVLKSQPFPVVISKGKQLGENQLVVLVLTGARSNFHINGPVKATMICDSHPTNKNNP
TTPLEMDSQPIYPATLTAHFPLKFLAGTRKCSVNLKFGVNIRDLDNVTTTVESDASNPFV
VITNECQWEGSAGVLLKKDAFDGQLEITWAQFINTLQRHFLIATKQDPVRPKRPLSSYDL
KYIQTHFFGNRSIIHQQDFDKFWVWFGKSMQTLRYQRHISTLWQEGIIYGYMGRQEVNDA
LQNQDPGTFIIRFSERNPGQFGIAYIGVEMPARIKHYLVQPNDTAAAKKTFPDFLSEHSQ
FVNLLQWTKDTNGAPRFLKLHKDTALGSFAPKRTAPVPVGGYEPLNS
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgtcatcagcagaattctcaatggacgattttgaagatacttttgactcaaacgcaact
atctctactaaagatttatttgaaggttcagataggttaccattaaatcaaagtataaat
acaacaattcaaaatttatatttaccaaatggtggatttgcaattggcgatcaaagccaa
caacaatattaccaagcaatgccaccattaaaccaaagtgatcaattcaatttaggaaga
tcaaataatttgacaccaagaacaaatcaacttcaacaacttcaacaacaacaacaacaa
caacaacaaccacaacaacaacaacaacaacaaacatatggtactcaatcaccaattcat
atgtcacaaactccttcaagtcctttatcatctccattaccaagtccaactccattcagt
agacaacaaagttataacaacaacaatagtaataatacttcatcatcacaaaattataat
aataataacattaacatcaataacaataacaacaataacaatacaaacaataacaacaac
aacaataatggtaacaatagtaatggtaacaatggtaataataataacaacaacaacaac
aataacaataacaatactaacaataataataataataatcaacaacaacaacaacaacaa
caacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaaggtaatccaaat
ttaagttcaccacaaccaattcttgatacaatttataaattattatcagaacaagaacaa
acattagttcaaatgattcatgaacaatcattgttattaaataggttaccaccaacattg
gatgaaaattcattagcaccactcaaatcattatctcaaaaacaaatcacattatccggt
caaatgaatactgaaatgtcagcacttgatgccactaaaaaaggtatgatccttgaacca
acagatttagcaaaattatttgctttaaaacaagatttacaaattcaatttaaacaatta
agtttattacataatgaaattcaatcaattttaaatccacaacattctgcaccaaaacca
aatgttgcacttgtattaaaatcacaaccattcccagttgtaattagtaaaggtaaacaa
ttaggtgagaatcaattagttgtattagtattaactggagcaagatcaaactttcatata
aatggaccagttaaagcaacaatgatttgtgattcacatccaaccaataaaaataatcca
actacaccattggaaatggattcacaaccaatttatccagcaacattgacagcacatttc
ccattgaaattcttggctggtactagaaagtgctctgtcaatttgaaatttggtgtaaat
attcgtgatttagataatgttaccacaaccgtagagagtgatgcatccaatccattcgtt
gttatcaccaatgaatgtcaatgggagggtagtgctggtgtattattgaaaaaggatgct
ttcgatggtcaattggaaatcacttgggctcaattcatcaatacccttcaaagacatttc
ttaattgccactaaacaagatcctgtaagaccaaaacgtccactctcttcctatgatttg
aaatatattcaaactcatttctttggtaatcgttcaatcattcaccaacaagatttcgat
aaattttgggtttggttcggtaaatcaatgcaaactcttagatatcaaagacatatttca
actttatggcaagaaggtatcatttatggttatatgggtagacaagaagttaatgatgct
ttacaaaatcaagatccaggcacatttattataagatttagtgaaagaaatcctggtcaa
tttggtattgcttatattggtgttgaaatgccagctcgaattaaacattatttggttcaa
ccaaatgatactgctgccgcaaagaaaactttccctgactttttatcagagcattctcaa
ttcgtaaacttacttcaatggactaaggatacaaatggtgcaccaagatttttaaaatta
cacaaagatactgctttaggttcctttgctccaaaaagaacagctcctgtacctgttggt
ggttatgaacctttaaatagttaa

DBGET integrated database retrieval system