KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281549
Entry
DDB_G0281549      CDS       T00245                                 

Gene name
coxA
Definition
(RefSeq) cytochrome c oxidase assembly protein
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00190  Oxidative phosphorylation
ddi00860  Porphyrin and chlorophyll metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DDB_G0281549 (coxA)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DDB_G0281549 (coxA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ddi03029]
    DDB_G0281549 (coxA)
Mitochondrial biogenesis [BR:ddi03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    DDB_G0281549 (coxA)
SSDB
Motif
Pfam: COX15-CtaA
Other DBs
NCBI-GeneID: 8623253
NCBI-ProteinID: XP_640642
dictyBase: DDB_G0281549
UniProt: O76740
Position
3
AA seq 482 aa
MLNRAGLRCLKPSIFKQTKSNLIINNSNILSVSSRLSKNNNINQSFNNGFLQSNSKLNSI
ISLNNNNNNYYKRFYSNENKTNSNEQVKEEEKTNDNSSNNNEEDYKEPEQSKGNKKVGNW
LLFSCGLVGAMIVIGGITRLTESGLSIVDWKPVVGAIPPITQEEWEAEFEKYKQFPEYKR
LNMGMTLSEFKEIFFWEYSHRLLGRVIGVAFFFPFVWYLKKGYINRSLAKKLSVVFLMGG
AQGALGWYMVKSGLDEKLIQDRGSDIPRVSQYRLAAHLGSAFVIYMALLWFGLGLVRPSA
LSPAMMQKLKSAMSTLAQQKSSFTIEKMKKYSHQVSGLIFLTAMSGAFVAGLDAGLVYNT
FPKMGHQWIPDDIINPKIKPAYKNMFEHDVTVQFQHRVLATITYGSILALSAFAYRGRLA
LSPKARLATNCLLAVGTAQVALGITTLLTFVPVSLGAAHQTGSLTLLSVAIWLLHELKKL
PK
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgttgaatagagctggtttaagatgtttaaagccatctatctttaaacaaacaaaatca
aaccttattataaacaatagtaatattttatcagtatcatctagattatcaaaaaataat
aatattaatcaaagttttaataatggttttttacaatcaaattcaaaattaaattcaata
atttcattaaataataataataataattattataaaagattttattcaaatgaaaataaa
acaaattcaaatgaacaagtaaaagaagaagaaaaaacaaatgataatagtagtaataat
aatgaagaagattataaagaaccagaacaaagtaaaggtaataaaaaagttggtaattgg
ttattattttcatgtggattagttggtgcaatgattgttattggtggtattacacgttta
acagaatcaggattatcaattgttgattggaaaccagttgttggtgcaattccaccaatt
actcaagaggaatgggaagctgaatttgaaaagtataaacaatttccagaatataaaaga
ttgaatatgggtatgacattgagtgaatttaaagagatcttcttttgggaatattctcat
cgtttattgggtagagttattggtgtagctttctttttcccatttgtgtggtatttaaag
aaaggttatatcaatcgttcactagctaaaaagttatcagttgtatttttaatgggtggt
gcacaaggtgcattgggttggtatatggtgaaatccggtttggatgaaaagttgatccaa
gatcgtggtagcgacataccaagagtcagtcaataccgtttagccgcccatttaggtagt
gcatttgtgatttatatggcattgctttggtttggcttgggcttggtcagaccatcagct
ttgtcacctgcaatgatgcagaaattgaagtctgcaatgtcgacacttgctcaacaaaaa
tcatcattcacaattgaaaaaatgaagaaatactctcatcaagtaagtggtttaatattt
ttaactgcaatgagtggtgcattcgtcgctggtttagacgctggtttggtttataatact
tttccaaaaatgggtcatcaatggattccagatgatatcattaatccaaagattaaacca
gcctacaagaatatgtttgaacatgatgttaccgttcagttccaacatagagttttggct
acaatcacttatggttcaattttagctttatccgctttcgcttatcgtggtcgtcttgct
ttgtcaccaaaagctcgtttagcaacaaattgtcttttagctgttggtaccgctcaagtc
gctttaggtattacaacccttttaacttttgttccagtttctttaggtgctgctcatcaa
actggtagtttaactttattaagtgttgccatttggttattacatgaattaaaaaaatta
ccaaaataa

DBGET integrated database retrieval system