KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281865Help
Entry
DDB_G0281865      CDS       T00245                                 

Gene name
adh5
Definition
(RefSeq) alcohol dehydrogenase, class 3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00071  Fatty acid degradation
ddi00350  Tyrosine metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0281865 (adh5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0281865 (adh5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DDB_G0281865 (adh5)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DDB_G0281865 (adh5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     DDB_G0281865 (adh5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 8623280
NCBI-ProteinID: XP_640467
dictyBase: DDB_G0281865
UniProt: Q54TC2
Position
3
AA seq 379 aa AA seqDB search
MSTEGKVITCKAAVAWEAKKPLVIEDIEVQPPQKGEVRIKILYTGVCHTDSYTLSGSDPE
GIFPCILGHEGGGIVESIGEGVTSVKVGDHVIPLYIPECGTCKFCTSNKTNLCSKIRITQ
GKGQMPDGTTRFKCKGKEIFHFMGTSTFSQYTVLPEISCCVVREDAPLDKVCLLGCGITT
GFGAAKITAKVEEGSTVAIFGLGAVGLSVAQGAVDCGAKRIIGIDNNETKFGPGKDFGCT
EFINPSKDLPEGKTIQQHLVDITDGGVDYSFECIGNVNVMRAALECCHKGWGVSTIVGVA
PAGAEISTRPFQLVTGRVWKGSAFGGVKSRSQLPSIIDKYMDKKLKVDEYVTFTYPLNEI
NTAFDVMHEGKSLRSVVNL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaggtaaagttattacatgtaaagcagcagtggcttgggaagccaagaaa
ccattggtaattgaagatattgaagttcaaccaccacaaaaaggtgaagtcagaattaaa
attttatatactggtgtttgtcatacagattcatatacattaagtggtagtgatccagaa
ggtatttttccatgtattttaggacatgaaggtggtggtattgttgagagtattggtgaa
ggtgttacaagtgttaaagttggtgatcatgtaattcctttatacattccagaatgtgga
acatgtaaattctgtacaagcaacaagactaatctttgttcaaagattcgtatcactcaa
ggtaaaggtcaaatgccagatggtaccacaagattcaaatgcaagggtaaggaaatcttc
cactttatgggcacaagcactttctcacaatacactgttctcccagagattagttgttgt
gtcgttagagaggatgcaccattggataaggtttgtttgttgggttgtggcattaccact
ggtttcggtgccgccaaaatcacagcaaaagtcgaagaaggctcaaccgttgccatcttt
ggtttgggtgcagttggtttgagtgtcgcccaaggtgctgtcgattgcggtgccaaacgt
atcattggtatagataataatgaaactaaatttggaccaggtaaagattttggttgtaca
gaattcatcaatccatcaaaagatttaccagagggcaaaaccattcaacaacatttggtc
gatatcaccgatggtggtgtcgattattcattcgaatgtataggtaatgtcaatgtaatg
agagccgctttggaatgttgtcataaaggttggggtgtttcaaccattgttggtgttgct
cctgctggtgctgaaatttcaactcgtccattccaattggtaaccggtcgtgtttggaaa
ggttctgcttttggtggtgtaaaaagtcgttctcaactcccatcaatcattgataaatat
atggataagaaattaaaagttgatgaatatgttacctttacatatccattaaatgaaatt
aatactgcatttgatgttatgcatgaaggtaaaagtctccgttcagttgtaaacctctag

DBGET integrated database retrieval system