KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281877
Entry
DDB_G0281877      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K14724  solute carrier family 9 (sodium/hydrogen exchanger), member 8
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ddi02000]
    DDB_G0281877
Transporters [BR:ddi02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   DDB_G0281877
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 8623287
NCBI-ProteinID: XP_640474
dictyBase: DDB_G0281877
UniProt: Q54TB5
Position
3
AA seq 687 aa
MKKKTVFFSLAILLVILFNQILEIKSEATTTTSLTISTSNEGSSSTSNKFIVKGEENEYE
NEGGECKDNIGCGRNASRLILSFLFLILLSMLVIYVLTRINIHYIPESLAVVVYGIIIGI
IIKYSNVDTFKHLASYNPNEFFLFILPLIIFETGLTLNKKEFFRNIKSILVLATIGTLIA
FLLTGFGLYLLGIWGVSPKITLFESLLVSSISSATDPVATLGIFKVLDVDPTLFLIVLGE
SILNDAVSVILYDSVLQYDNIKELWKPVLLFFGISIGSVIIGVLISIILTLLLKFTTIKF
TTTTNTTNTTTTDATSSTFRLFEIIFIIIISYSSYIIADSIYLSGILSSFFCGITSSHYL
YKSLSDETKQSISQLFRMIAFIGETIVFIYIGLVLPNFNFQFNIKLLVWTFLLLLISRAI
SIFPTFFIINKLNNKNKLNNNKNNNNGGGGGNMVSIGIQIVIWVSGLRGAISFSLMEESE
IQENVSSIESANLLKTDILMIVYSTLFIFGSLTYPILKLLKIKTDVSSTINKDSQDNDDS
SVDDSSGGSDSNKLLKNFKQRSGALYRVFKYLIYLDNFLLNFFSNKKGLSPRMKSSISSS
FKCDNDDKNIGGDGNNRNSIQLETFNNRHFSFNKDDEDYYDDNQTQNESNSGRELLFTMD
SENETTTSTTTAHDNKNNKNNNNNDDE
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgaaaaagaaaacagtatttttttcattagcaattttattggtaatactttttaatcaa
attttagaaataaaaagtgaagctactactactactagtttaaccatcagcaccagtaat
gaaggtagtagtagtacaagtaataaatttattgtaaaaggagaagagaatgaatatgaa
aatgaggggggtgaatgtaaagataatataggatgtggtagaaatgcaagtagattaata
ttatcattcctttttttaattttactttcaatgttagtaatctatgttctcactagaata
aatattcattatataccagaatcattagcagtagtagtatatggtataatcattggtata
atcatcaaatattcaaatgttgatacatttaaacatttagcatcatataatccaaatgaa
ttctttttattcattttaccattaatcatatttgaaactggtttaactttaaataaaaaa
gaattctttagaaatataaaatcaattttagtattagcaactattggtacacttatagca
tttttattaacaggatttggattatatttattaggtatttggggagtttcaccaaagata
acattatttgaaagtttattagtatcttcgatatcatcagctacagatccagttgcaaca
ttaggtattttcaaagttttagatgtagatccaacattatttttaattgtattaggtgag
agtatactaaatgatgcagtatcagttatattatatgattcagtattacaatatgataat
attaaagaactttggaaaccagttttattgtttttcggtatttcaattggtagtgtcata
attggtgtattaatatcaatcattttaacattattattaaaatttacaacaattaaattc
acaacaacaacaaatacaacaaatacaacaacaacagatgcaacatcatcaacatttaga
ttatttgaaattatatttataataattatatcatattcatcatatataattgcagattca
atttatttatcaggaatattatcatcattcttttgtggtataacatcaagtcattattta
tataaatcattatcagatgaaactaaacaatcaatttcacaattatttagaatgattgca
tttattggtgaaacaattgttttcatttatattggtttagttttaccaaattttaatttt
caatttaatattaaattattagtttggacttttttattattattaatttcaagagcaatt
tcaatatttccaacattttttataattaataaattaaataataaaaataaattaaataat
aataaaaataataataatggtggtggtggtggtaatatggtatcaataggaattcaaatt
gtaatttgggtatcaggattaagaggtgcaatttcattttcattaatggaagaaagtgaa
attcaagaaaatgtttcatcaattgaatcagcaaatttattaaaaactgatattttaatg
attgtttattcaacattatttatttttggttctttaacttatccaatattaaagttattg
aaaattaaaactgatgtttcatcaacaattaataaagatagtcaagataatgatgatagt
agtgttgatgatagtagtggtggtagtgatagtaataaattattaaaaaattttaaacaa
agatctggtgctttatatagagtttttaaatatttaatttatttggataatttcttatta
aatttcttttcaaataaaaaaggtctttcacctcgtatgaaatcttcaatttcttcaagc
tttaaatgtgataatgatgataagaatattggtggtgatggtaataatagaaactcaatt
caattggaaacatttaataatagacattttagtttcaataaagatgatgaggattactat
gatgataatcaaactcaaaatgaaagtaatagtggaagagaattattatttacaatggac
agtgaaaatgaaacaactacatcaacaacaactgcccatgataataaaaataataaaaat
aataataataatgatgatgaatag

DBGET integrated database retrieval system