KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281889
Entry
DDB_G0281889      CDS       T00245                                 
Name
(RefSeq) hypothetical protein
  KO
K07374  tubulin alpha
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0281889
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ddi03019]
    DDB_G0281889
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0281889
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ddi04812]
    DDB_G0281889
   04147 Exosome [BR:ddi04147]
    DDB_G0281889
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     DDB_G0281889
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Other tubulins
     DDB_G0281889
Cytoskeleton proteins [BR:ddi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    DDB_G0281889
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0281889
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0281889
  Exosomal proteins of colorectal cancer cells
   DDB_G0281889
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 8623297
NCBI-ProteinID: XP_640483
dictyBase: DDB_G0281889
UniProt: Q54TA6
Position
3:5074777..5076633
AA seq 452 aa
MREIISIHIGQAGIQVGNSCWELYCLEHGIDKDGTFKKDYKRGNDVKYETFFRESSTKDK
VVPRSLFIDLEPTVIDEIRSGDYRELFHPNQLINGKEDAANNYARGHYTVGKELLDLSLQ
RIRELTDECDGLQGFFLFHSVGGGSGSGFGSLLLQKLASEYGKKSKIDFCIYPSPQVSTA
VVEPYNCVLSTHSLLEHCDVTFMLDNEAIYDVCKKKLHIERPSYANLNRMIAQVISSLTS
SLRFPGQLNVDINEFQTNLVPFPRIHFLLASYAPLISIENANHEQVTVSAITNSVFSNDN
LLAKCDPSSGKYMSCCLLYRGNMTPNEAQTAVADIKTQKSKTVNFTSWSKGTGFKCGINS
SIPTVVPGGDMANIEKAVCLLSNTTSISQIFNRLNRKFSLMFEKRAFVHWYVGEGMEEGE
FAEARDDLLALEKDYESLAEDLDDEQVEEQEY
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcgtgaaattatttctattcatataggtcaagctggtatccaagttggtaattcatgt
tgggaactatattgtttggaacatggaatagataaagatggtacatttaaaaaagattat
aaaagaggtaatgatgtaaaatatgaaacattttttagagaatcatcaactaaagataaa
gttgtaccacgttctttatttattgatttagaaccaacagttattgatgaaattagaagt
ggtgattatagggaattatttcatccaaatcaattaattaatggaaaagaagatgctgca
aataattatgcaagaggacattatacagttggtaaagaacttttagatttatcattacaa
agaattagagaattaacagatgaatgtgacggattacaaggatttttcttattccatagt
gttggtggaggttcaggttcaggatttggttcattattattgcaaaaattagcttcagaa
tatggtaaaaaatcaaaaattgatttttgtatttatccatcaccacaagtttcaacagct
gtagttgaaccatataattgtgtactttcaactcattctttattagaacattgtgatgtt
acatttatgttagataatgaagcaatttatgatgtttgtaaaaaaaaattacatattgaa
cgtccatcatatgcaaatcttaatagaatgatagcacaagttataagttcattaacatca
tcacttcgttttccaggtcaattaaatgttgatattaatgaatttcaaaccaatttagtt
ccattcccacgtattcatttccttttagcatcatatgcaccattaatttcaatagagaat
gcaaatcatgaacaagttacagttagtgcaattacaaactctgtattcagtaatgataac
cttttggctaaatgtgatccaagttctggtaaatatatgtcttgttgtcttttatatcgt
ggtaatatgacaccaaatgaagctcaaactgctgttgctgatattaaaactcaaaaatca
aaaactgttaattttacaagttggtcaaaaggtacaggttttaaatgtggtattaattca
tcaataccaacagtggttccaggtggtgatatggcaaatattgagaaagctgtttgttta
ctttcaaatacaacttcaatttcacaaatctttaatagattaaatagaaaattttcatta
atgtttgaaaagagagcatttgttcattggtatgttggtgaaggtatggaagaaggtgaa
tttgctgaagcaagagatgatctacttgccttggaaaaagattatgaaagtttagctgaa
gacttagatgatgaacaagtagaagaacaagaatattaa

DBGET integrated database retrieval system