KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282203
Entry
DDB_G0282203      CDS       T00245                                 

Symbol
rabY
Name
(RefSeq) Rab GTPase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Ras Roc Arf CCDC53 eIF-3_zeta CobT Velvet DUF5308 EIF4E-T ATPase_2 AAA_14 DDHD MMR_HSR1 Presenilin AAA_22 Neur_chan_memb RR_TM4-6 DUF4518 DUF6264 PRC2_HTH_1 DUF1980 TFIIA EIIBC-GUT_N Serinc EPL1 SpoIIP DUF4834 Peroxin-13_N YABBY TERB2
Other DBs
NCBI-GeneID: 8623461
NCBI-ProteinID: XP_640284
dictyBase: DDB_G0282203
UniProt: Q54SV1
Position
3
AA seq 236 aa
MNSEKPDYNYLFKIVIIGDRKTGKTCLMNRFVENTWSEEYRQTNLLHFKVKTIYIDCKII
KLQIWDSQADENFRFNNNNLSNYRSASGFLVVYDCTNENSFSNLKHWIKDIKLYGRPNAI
NIVVSNKSDLVNEKVIDSDVAKSYCDSLEIPFIETSSKHSSNVEDCFVLLIKNVMKYLET
EPTIPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQSSKTKIGCLIQ
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaattcagaaaaaccagattataattatttatttaaaattgtaataattggtgataga
aaaacaggaaaaacatgtttaatgaatagatttgtagagaatacatggagtgaagaatat
agacaaactaatttattacattttaaagttaaaactatctatattgattgtaaaattatt
aaattacaaatatgggatagtcaagcagatgaaaattttagatttaataataataattta
tcaaattatagaagtgcatcaggttttctggttgtttatgattgtactaatgagaattca
tttagtaaccttaaacattggattaaagatattaaattatatggacgtcctaatgcaata
aatattgttgtttcaaataaatctgatttggtcaatgaaaaagtcattgactcagacgtt
gcaaaatcatattgtgatagtttagaaataccattcattgaaacaagttcaaaacattct
tcaaatgttgaggattgttttgttttattgattaaaaatgttatgaaatatttagaaact
gaaccaactattccacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaccagcaaagttcaaagacaaaaattggatgtttaattcaatag

DBGET integrated database retrieval system