KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282245Help
Entry
DDB_G0282245      CDS       T00245                                 

Gene name
forD
Definition
(RefSeq) actin binding protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_GBD Drf_FH3 DUF3361
Motif
Other DBs
NCBI-GeneID: 8623482
NCBI-ProteinID: XP_640306
dictyBase: DDB_G0282245
UniProt: Q5TJ55
Position
3
AA seq 1214 aa AA seqDB search
MVKLFGKSKKKEESPQSIDIAFQSILDEIGVVETEKKHLMATMDTVRKQQLIQSYSSKKF
SKNEFGNKSKKKSIITQSPHYFVDCLKNDPSKEVLTSLRVRLGNQPLKWLKEFLSLDGVS
LLIKVLILNEIKQVKNQEDIYKIAQCLHSLKLIMNTKFGLESVIKQPTNIHSISLVMDTP
HLKTRIMVIELLAALCVVNSKGLPLVLSAMDNYREVKREKKPFIHLFQGLKNPSGSLQAT
TFALINTLISSSQSVEERQKIRNQFKKLGITKVIEELEPEYANNPDLATQKDLYEQECRW
DEQEQIENARGDISDENPEALVKAILDRTAGGPLYSSFTSILRLLANSITDQTKDQSLSN
YLFVEKVIGKMNNGESYLDDIGTFFGGGGGGDGSLDIAHVSGEKAVLIQKEIEDLKKQKK
RDQDKLAEKDKLLTKLAKRMRKMEEAIKLGKGLEYLNNQIEIESPPDSSTSTPQETTPGG
TKVPLKTSPVTKADLKHKLSTFTTAKAPNGVSDFLSGLDTTNQQGSTDASQTEAGSGDGI
PLPPGAPPPPPPPGGKLAPSTPQLCSRPPSIKMKSYQWTRYRTRNVTNTFWKNVNLTKYN
DCLPHEQIEGLFGAAIFEKKEKELKKGSEVTVIDTKRAQNIGILLSRFKNVTHDAIYDAI
YSLDESILDLETINQFIKYIPSKEEIDCIIAFKQQQEQLPEEERMKLGKSEIFIDKISTI
PRLEQRIQALHFKLNFPDKLYHAKPDIRKFNEAFVQLQNNNIFAIMELILSIGNFINFGT
NRGNASGFKIDSINKMADTKSNIREKYTLVHYLIELLESTQPELLKVFDEIPSVVDAATL
SFNQSSSEIKLLRAGLIKLEKEIFVRQPKSVEPKPDDETINNNGEDDINNTSSDEKTEGQ
QQRQGEEEENDESESTGNSFADSLKKKKSQVNTNSTSDSKQSLEPLKDDDPLKLKLSEFL
LASKTELDDTETLIAETEVLFKSICKFFGEDSTKIQPEEFLAIFKKFNDKFIMSKKDLEI
EKSIKDKSTQRKNEKERKEMEIKKSKLEMIHSKLKKIGSPSSSNRILASNESSPTSSTSS
VVHQHDDEDEETIKEYINNPSPSQQSNSSEEEGMMDDLLNLIRDGNFRELRRMNLQQKKP
VRTKRVIAKQPTRPQALDTPSSTYSSISSIYDAEPLDMSDQEDEDEEEEEDEEEEEEEEE
GDDDNDNDEEEGEN
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattgtttggaaaatcgaagaaaaaggaggaatctcctcaatccattgatatt
gcattccaaagtattttggatgaaattggtgttgttgaaacagaaaaaaaacatttaatg
gcaacaatggatacagttagaaaacaacaattaattcaatcatattcaagtaaaaaattt
tcaaagaatgaatttgggaataaatcaaaaaagaaatcaattataactcaatcaccacat
tactttgtagattgtttaaaaaatgacccatctaaagaagtattgacatcattacgtgtt
cgtttgggtaatcaaccactaaaatggttgaaagaatttttatcattagatggtgtatca
ttattaattaaagttttaattttaaatgaaattaaacaagttaaaaatcaagaagatatt
tataaaattgcacaatgtttacattcattaaaattaataatgaatacaaaatttggatta
gaatcagttataaaacaaccaactaatatacattcaatttcattggttatggatacacca
catttgaagactagaatcatggttatagaattattggcagcattatgtgttgtaaattcc
aaaggtttaccattggtattgagtgcaatggataactatagagaagtaaagagagagaag
aaaccattcattcatctttttcaaggtttaaagaatccttctggttcattacaagctact
acatttgcattgattaatacattgattagtagtagtcaaagtgttgaagagagacaaaag
attagaaatcaatttaaaaagttgggtattacaaaggtgattgaggaattggagccagaa
tatgcaaataatccagatttggcaacacaaaaagatctatacgaacaggaatgtagatgg
gatgaacaagaacaaattgaaaatgcacgtggtgatatctctgatgaaaaccctgaagca
ttggtaaaggcaatccttgatagaactgctggtggtccattgtattcttcattcacttca
atcttaagattattggcaaattcaatcactgatcaaacaaaggatcagtcattgtcaaac
tatttattcgtagagaaggtcattggtaaaatgaataatggtgaatcttatctcgatgat
attggtacattttttggtggaggtggtggtggtgatggtagtttagatatcgctcatgta
tctggagagaaagcagtactcattcaaaaggagattgaagatttaaagaaacaaaaaaag
agagatcaagataaattggcagagaaagataaactcttaactaaattggcaaagagaatg
agaaagatggaagaggcaattaaattaggtaaaggtttagaatatttaaataatcaaatt
gaaattgaatcaccacccgattcatctacaagtacaccacaagaaacaacacctggtggc
accaaagtacctttgaaaacttcaccagttacaaaggctgatcttaaacataaactttca
acatttacaactgctaaagctccaaatggtgtaagtgatttccttagcggtcttgatacc
actaatcaacaaggaagtacggatgcatctcaaactgaagctggtagtggcgacggtata
cctttaccaccgggagcacctcccccacctccaccaccaggtggtaaattagcaccatca
acaccacaactatgttcacgtccaccatcaattaaaatgaaatcatatcaatggacacgt
tatcgtactagaaacgttaccaatacattctggaagaatgttaatctcacaaagtataat
gactgtttaccacatgaacaaattgaaggtttatttggtgcagccatatttgaaaagaaa
gaaaaggaattgaaaaaaggatcagaggtaactgttattgatacaaagagagctcaaaac
attggtattctcttatcaagatttaaaaatgttactcatgatgcaatctatgatgcaatc
tatagtttggatgagtcaatattggatcttgaaaccattaatcaattcataaagtatatt
ccatcaaaggaagaaattgattgtatcattgcatttaaacaacaacaagaacaactacca
gaggaagagagaatgaaattgggtaaatctgaaattttcattgataaaatctctaccatt
ccaagattagaacaaagaattcaagcattacatttcaaattgaatttccctgataaatta
tatcatgcaaaaccagacattagaaaattcaatgaggcatttgttcaacttcaaaataat
aatatatttgcaattatggagttaattctttccattggtaatttcattaattttggtaca
aatcgtggtaatgcaagtggtttcaaaatagattcaatcaataaaatggctgatacaaaa
tcaaatattcgtgaaaagtatacactagttcattatctcattgagttattagaaagtact
caaccagaattattaaaagttttcgatgaaattccatcagttgttgatgctgctactctt
tcatttaatcaatcatcttctgaaattaaattattaagagctggtttaattaaattagaa
aaagaaatttttgttagacaaccaaaatcagttgaaccaaaaccagatgatgaaactatt
aataataatggtgaagatgatataaataatacctctagtgatgaaaaaactgaaggtcaa
caacaaagacaaggagaagaagaagaaaatgatgaaagtgaatcaactggtaatagtttt
gctgatagtttaaagaaaaagaaatctcaagttaatacaaattcaacatcagattcaaaa
caatcattagaaccacttaaagatgatgatccattaaaattgaaattgtcagaattttta
ttagcatcaaagacagaattggatgatactgaaactttgatagcagagacagaggttctc
tttaaatcgatttgtaaattctttggtgaggatagtacaaaaattcaaccagaagaattt
ttagcaatctttaaaaagtttaatgataaatttataatgtctaaaaaggatttggaaatt
gaaaaatccattaaagataaatcaactcaaagaaagaatgaaaaggagagaaaagaaatg
gagattaaaaaatcgaaattggaaatgattcattcgaaattaaagaaaattggttcacct
tcatcctccaatagaattcttgctagtaatgaatcatcaccaacctcttccacaagttca
gtggttcatcaacatgatgatgaagatgaagaaactatcaaagagtatatcaataatcca
agtccatctcaacaatcaaattcttcagaggaagaaggaatgatggatgatttattgaat
ttaattcgtgatggtaatttcagagaattgagaaggatgaatcttcaacaaaagaaacca
gttagaactaaaagagtaattgctaaacaaccaactcgtccacaagctttagatacacct
tcttcaacatattcttcaatctcatctatatatgatgctgaacctcttgatatgagtgat
caagaagatgaagatgaagaagaagaagaagatgaagaggaggaagaagaagaagaggaa
ggagatgacgataatgataacgatgaagaagaaggtgaaaactaa

DBGET integrated database retrieval system