KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282633
Entry
DDB_G0282633      CDS       T00245                                 

Definition
(RefSeq) BTB/POZ domain-containing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: RCC1 RCC1_2 BTB Ank_2 Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 8623703
NCBI-ProteinID: XP_640165
dictyBase: DDB_G0282633
UniProt: Q54S74
Position
3
AA seq 919 aa
MSLFYTKDAISDFEKILNGLNTFDSFPPLRILSLATYCRKEEVKDFFSFIDSNGDTCLTF
IIQSTVENNVTQQYRSIVDKFKLLEENIELLNLPNSYGETPLHVSSISNNIEFMKLLVLQ
GVDGSLKDNRNMTALDIAVMMDHKTIIKELKKLKTSMMTMEQTSIYQWGQILTSSLTLKS
CAKATNMLFNDEISAPIQTEFGQNYNLILTDTGAVYSSGLCSYGKTGHKKKRDVLIPTQI
LELSNKRIKSIACGTHHSLAMDDLGQVYSWGNGASGRLGLGNDFSIVPTPTLISVINRFG
SNEIATAIAAGCDNSMILGSNGDVYSFGSNLHYKLGYKECDGALGFQSTPKKIPSILQMK
SIACASWHSVFLDLKGRVYTCGSSTNGRLGRAISSYSSFYPERVSITNSKTNGTLPQEEV
IKQIACGTNFTTVLSESGSLYSWGVNTKSQLGLINLVGISEYYSQPKLVTALNPYTIHSF
AVGDQHVVALSDQGEVFCYGDNSTLQCGFGEVLNFEINLTKVKIETTSSDAPIIGGGGVF
KVSAGGSNTMISLSSDHNIFGEELLKSLNLQMFTDCRLIINDNKEQFIQAHQVVLAARSN
KFNKLLELQHNSTLVGVDQQQQQQQQCKIPLTQTTFLKSFIESIGTFDIDGNENRVLYIS
FPSISSISILSLLLKYIYSDHTILSQSTNQELGELAHSLEIERLAYLCNFSHGKSLDKLP
TSTLLEDFRILKDPKFSSIYSDIKFKCINNGGGGGDGNMVDEAYLEKNKQQIETVESYKL
FAYTGSSYFKTMLSGSFIESNKKEIELFETSASSLRLLLNYCYSEEIPTDSNDCIDCIII
CDVHQISRAKDSCAAKIRSQIDIQYICYIYHISLIYNVKLLKTWCQANFNSIADIKALPY
FNQLPIEIQSELNSIKKKY
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgtcattattttatacaaaagatgcaatttcagatttcgaaaaaatactaaatggttta
aatacatttgattcattcccacctttaagaattttatctttagcaacttattgtagaaaa
gaagaagttaaagatttttttagttttatagattcaaatggtgatacttgtttaacattt
ataattcaatcaaccgttgaaaataatgtaacacaacaatatagatcaattgtagataaa
tttaaattattagaagaaaatattgaacttttaaatttaccaaattcatatggtgagaca
ccattacatgtttcatcaatatcaaataatatagagtttatgaaattattagttttacaa
ggagttgatggatcattaaaagataatagaaatatgacagcattggatattgcggtgatg
atggatcataaaacaattattaaagaattaaagaaattgaaaacatcaatgatgacaatg
gaacaaacatcaatttatcaatggggtcaaattttaacaagtagtttaacattgaaatca
tgtgcaaaagcaaccaatatgttatttaatgatgaaatttcagcaccaattcaaacagag
tttggacaaaattataatttaattctaactgatactggtgcagtgtatagttcaggttta
tgctcctatggtaaaacagggcataaaaagaagagagatgtattaataccaacacaaata
ttagaattatcaaataaacgtatcaaatcaatcgcatgtggtacacatcattctttggca
atggatgatttgggtcaagtttattcttgggggaatggcgcaagtggtaggttgggcctg
ggtaacgatttcagtatagtaccaacaccaacattaatcagcgttatcaatagatttggt
tctaatgaaattgccactgcaattgcagcgggttgtgataattcaatgatattaggctca
aatggagatgtatacagtttcggcagtaatttacattataaacttggttataaggagtgt
gatggcgcattggggttccaatcaactcctaagaaaataccatcaatacttcaaatgaaa
tcaattgcatgtgcaagttggcattctgtattcttggatctcaaaggcagagtttataca
tgtggttcaagtacgaatggtagattgggtcgagcaattagttcctatagttcattttac
ccagaacgtgtctcaatcaccaatagcaaaaccaatggaacacttccacaagaggaagtc
attaagcaaattgcatgtggtactaattttacaacagttttatctgaaagtggttcactc
tattcatggggtgtaaatacgaaatctcaattgggtttaattaatttagttggaatttca
gagtattattctcaaccaaaattagtaactgctttaaacccttatacaattcattcattt
gctgttggcgatcaacatgttgtagcattgtctgatcaaggtgaagttttctgttatggt
gataatagtacgcttcaatgtggttttggtgaagtattaaattttgagattaatttaaca
aaagttaaaattgaaactacttcatccgatgcaccaatcattggtggtggtggtgttttt
aaagtttctgcaggtggttcaaatactatgatatcattatcatcagatcataatatattt
ggtgaagaattattaaaatctttaaatcttcaaatgtttacagattgtcgtttaattatt
aatgataataaagaacaattcatacaggctcatcaagttgttttagcagcacgttcaaat
aaatttaataaattattggaattacaacataattcaactttggttggtgttgatcaacaa
caacagcaacaacaacaatgtaaaataccactcactcaaactacatttttaaaatcattt
attgaatcaattggtacatttgatattgatggtaatgaaaatagagtattgtatattagt
tttccatcaatttcatcaatttcaatattatcattattattgaaatatatttactctgat
catactattctatcacaaagcactaatcaagagttgggtgaattagcacatagtttagaa
attgaaagattagcatacctttgtaatttctcacatggtaaatcattagataaattacca
acatcaacattacttgaagattttagaattttaaaagatcctaaattctcttcaatttat
tcagatattaaatttaaatgtattaataatggtggtggtggtggtgatggtaatatggta
gatgaggcatatttagaaaaaaataaacaacaaattgaaacagttgaaagttataaatta
tttgcatatacaggttcaagttattttaaaacaatgttaagtggtagttttattgaaagt
aataaaaaagagattgaattatttgaaacttcagcatcaagtttaagattacttttaaat
tattgttacagtgaagaaattccaaccgattcaaatgattgtattgattgtattatcatt
tgtgatgttcatcaaatttcaagagcaaaagattcttgtgctgctaaaattagatctcaa
attgatattcaatacatttgttacatttatcatatctctttaatctataatgtaaaatta
ttaaaaacttggtgtcaagctaattttaatagtatagctgatattaaagcattaccttat
tttaatcaattaccaatagaaattcaatcagaattaaattcaataaagaaaaaatattaa

DBGET integrated database retrieval system