KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282653
Entry
DDB_G0282653      CDS       T00245                                 

Name
(RefSeq) Rab GTPase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Ras Roc MMR_HSR1
Other DBs
NCBI-GeneID: 8623716
NCBI-ProteinID: XP_640177
dictyBase: DDB_G0282653
UniProt: Q54S62
Position
3
AA seq 210 aa
MCDYDFIFEFLVIGDCNVGKSSFVYQYCENFKTKIRSRERGDGNTFIPKLIRVDDKNCFL
KFVKYYKRVNCLPNYRFINIADCIFILFDVCNRESFDNVGHYYNEILKYSSENLLITLIG
CKADLLNREVDQNEALEFSKKHNIPYFEVNNFSPSEIEKNVYQQISQTILPELVNINSTT
QPITENQHPPTKPHSPPIKNSFFKFWIKNK
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtgtgattacgatttcatatttgaatttttagtaattggtgattgtaatgttggaaaa
tcatcntttgtatatcaatattgcgaaaactttaaaaccaaaataagaagtagagaacgt
ggtgatggtaatacatttatacctaaattaataagagttgatgataaaaattgtttttta
aaatttgttaaatattataaaagagtaaattgtttaccaaattatagatttataaatata
gcggattgtatatttatactatttgatgtttgtaatagagaatcatttgataatgttgga
cattattataatgaaattttaaaatattcaagtgaaaatttattaattacattaattggt
tgtaaagctgatttattaaatagagaagttgaccaaaatgaagcattagaattttccaaa
aaacataatataccctattttgaagttaataatttttcaccttcagaaattgaaaagaat
gtttatcaacaaatctcacaaactattctaccagaacttgtaaatattaattcaactact
caacctataactgaaaatcaacatcccccaactaaaccccactctcctccaattaaaaat
agttttttcaaattttggataaaaaacaaataa

DBGET integrated database retrieval system