KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283157Help
Entry
DDB_G0283157      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K04460  serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ddi01009]
    DDB_G0283157
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     DDB_G0283157
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     DDB_G0283157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos PPP5 TPR_2 TPR_1 TPR_8 TPR_19 TPR_7 TPR_16 TPR_11 TPR_6 TPR_14 TPR_12 Fis1_TPR_C
Motif
Other DBs
NCBI-GeneID: 8623945
NCBI-ProteinID: XP_639169
dictyBase: DDB_G0283157
UniProt: Q54RH6
Position
4
AA seq 514 aa AA seqDB search
MTKVETLEFPRRKKESNENSTLSQPDAAAELNKDDKETDPSTLSKEECIKKSDEYKAIAN
KHFSEQKYDLAAEVYTKAIKYHPTAILYSNRSFSNFKNELYVNALQDAQTSHEMDPTYIK
AYYRLGSAHLALRNFEEAKHFFKELLTKNPKENDAKIKLNLCNNLIKAKLFEDAILITPE
SYFKELDINSMNVEESYKGPKFESEKITIEFVNEMIEWMKGQKSVHKKYVCKILKQSFEM
MKELPTLVDIDHDTTMNITICGDTHGQFYDLLNIFKINGSPSEEKPYLFNGDFVDRGSFS
FEIIITLLAYKLLYPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFDLFSELFNWFP
LAFVLDESFMVVHGGLFGKDGVTLDDIRKIKRNAPDPKDNELVQCLLWSDPQSNPGIAPS
SRGVGVYFGPDVTRRFLKENNLSTIIRSHEVKEKGYQIDDDGSLITVFSAPNYCDQSGNL
GSFINITEDKIKITTFEAVEHPNIPPMHYAKKYF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagttgaaactcttgaatttccaagaagaaaaaaggaatcaaatgaaaattca
accttatcacaaccagatgcagcagctgaattaaataaagatgacaaagaaactgaccct
tcaacactttcaaaagaagaatgtattaaaaaatctgatgaatataaagcaattgcaaat
aaacattttagtgaacaaaaatatgatttagcagcagaagtttatacaaaagcaattaaa
tatcatccaacagcaattttatattcaaatagatcattttcaaattttaagaatgagtta
tatgtaaatgcattacaagatgctcaaacctctcatgaaatggatccaacttacataaaa
gcatattatcgtttaggtagtgcacatttagcattaagaaattttgaagaagcaaaacac
tttttcaaagaactcttaacaaagaatccaaaagaaaatgatgcaaagattaaattaaat
ctttgtaataatttaattaaagcaaaattatttgaagatgcaattttaattacacctgaa
tcatattttaaagaattagatattaattcaatgaatgttgaagaatcatataaaggacca
aaatttgaaagtgaaaagattacaattgaatttgttaatgaaatgattgaatggatgaaa
ggacaaaagagtgtacataagaaatatgtttgtaagatattgaaacaatcatttgagatg
atgaaagagttaccaacattggtggatattgatcatgatacaacaatgaatataacgatt
tgtggtgatacacatggtcaattctatgatcttttgaatatatttaagattaatggatca
ccatcagaggagaaaccataccttttcaatggcgactttgtggataggggtagttttagt
tttgaaattatcatcactctattggcttataaattattgtacccaaatcatatgcatttg
acaaggggtaaccatgagacaaccgatatgaatcgtttctatggtttccaaggcgaagtg
gttgcaaaatacagtgagatggtattcgatctattctcagagttgttcaattggttccca
ttggcattcgtgttggatgaatcgtttatggtggtacatggtggtttgtttggtaaggat
ggtgtcacacttgacgatattagaaagattaaacgtaatgcaccagatccaaaagataat
gaattggttcaatgcttactttggtctgatcctcaatcaaatcctggtattgctccttct
tcaagaggtgtaggtgtttactttggacctgatgtcaccagacgtttcctcaaggaaaat
aatctatcaactatcattagatctcatgaagttaaagaaaaaggttatcaaatcgatgat
gatggttctctcatcactgttttctctgctccaaattattgtgatcaatctggtaatctt
ggctcatttataaatataactgaagataaaattaaaattacaacttttgaagctgttgaa
catccgaatataccaccaatgcattatgccaaaaaatatttctaa

DBGET integrated database retrieval system